Anti F5 pAb (ATL-HPA002036)
Atlas Antibodies
- Catalog No.:
- ATL-HPA002036-25
- Shipping:
- Calculated at Checkout
$328.00
Gene Name: F5
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026579: 60%, ENSRNOG00000057855: 63%
Entrez Gene ID: 2153
Uniprot ID: P12259
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | MPSPSSPTLNDTFLSKEFNPLVIVGLSKDGTDYIEIIPKEEVQSSEDDYAEIDYVPYDDPYKTDVRTNINSSRDPDNIAAWYLRSNNGNRRNYYIAAEEISWDYSEFVQRETDIEDSDDIPEDTT |
Gene Sequence | MPSPSSPTLNDTFLSKEFNPLVIVGLSKDGTDYIEIIPKEEVQSSEDDYAEIDYVPYDDPYKTDVRTNINSSRDPDNIAAWYLRSNNGNRRNYYIAAEEISWDYSEFVQRETDIEDSDDIPEDTT |
Gene ID - Mouse | ENSMUSG00000026579 |
Gene ID - Rat | ENSRNOG00000057855 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti F5 pAb (ATL-HPA002036) | |
Datasheet | Anti F5 pAb (ATL-HPA002036) Datasheet (External Link) |
Vendor Page | Anti F5 pAb (ATL-HPA002036) at Atlas Antibodies |
Documents & Links for Anti F5 pAb (ATL-HPA002036) | |
Datasheet | Anti F5 pAb (ATL-HPA002036) Datasheet (External Link) |
Vendor Page | Anti F5 pAb (ATL-HPA002036) |