Anti F3 pAb (ATL-HPA069132)
Atlas Antibodies
- Catalog No.:
- ATL-HPA069132-25
- Shipping:
- Calculated at Checkout
$351.00
Gene Name: F3
Alternative Gene Name: CD142
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028128: 70%, ENSRNOG00000011800: 68%
Entrez Gene ID: 2152
Uniprot ID: P13726
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | GTTNTVAAYNLTWKSTNFKTILEWEPKPVNQVYTVQISTKSGDWKSKCFYTTDTECDLTDEIVKDV |
| Gene Sequence | GTTNTVAAYNLTWKSTNFKTILEWEPKPVNQVYTVQISTKSGDWKSKCFYTTDTECDLTDEIVKDV |
| Gene ID - Mouse | ENSMUSG00000028128 |
| Gene ID - Rat | ENSRNOG00000011800 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti F3 pAb (ATL-HPA069132) | |
| Datasheet | Anti F3 pAb (ATL-HPA069132) Datasheet (External Link) |
| Vendor Page | Anti F3 pAb (ATL-HPA069132) at Atlas Antibodies |
| Documents & Links for Anti F3 pAb (ATL-HPA069132) | |
| Datasheet | Anti F3 pAb (ATL-HPA069132) Datasheet (External Link) |
| Vendor Page | Anti F3 pAb (ATL-HPA069132) |
| Citations for Anti F3 pAb (ATL-HPA069132) – 1 Found |
| Rosell, Axel; Moser, Bernhard; Hisada, Yohei; Chinthapatla, Rukesh; Lian, Grace; Yang, Yi; Flick, Matthew J; Mackman, Nigel. Evaluation of different commercial antibodies for their ability to detect human and mouse tissue factor by western blotting. Research And Practice In Thrombosis And Haemostasis. 2020;4(6):1013-1023. PubMed |