Anti F3 pAb (ATL-HPA069132)
Atlas Antibodies
- Catalog No.:
- ATL-HPA069132-25
- Shipping:
- Calculated at Checkout
$328.00
Gene Name: F3
Alternative Gene Name: CD142
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028128: 70%, ENSRNOG00000011800: 68%
Entrez Gene ID: 2152
Uniprot ID: P13726
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | GTTNTVAAYNLTWKSTNFKTILEWEPKPVNQVYTVQISTKSGDWKSKCFYTTDTECDLTDEIVKDV |
Gene Sequence | GTTNTVAAYNLTWKSTNFKTILEWEPKPVNQVYTVQISTKSGDWKSKCFYTTDTECDLTDEIVKDV |
Gene ID - Mouse | ENSMUSG00000028128 |
Gene ID - Rat | ENSRNOG00000011800 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti F3 pAb (ATL-HPA069132) | |
Datasheet | Anti F3 pAb (ATL-HPA069132) Datasheet (External Link) |
Vendor Page | Anti F3 pAb (ATL-HPA069132) at Atlas Antibodies |
Documents & Links for Anti F3 pAb (ATL-HPA069132) | |
Datasheet | Anti F3 pAb (ATL-HPA069132) Datasheet (External Link) |
Vendor Page | Anti F3 pAb (ATL-HPA069132) |
Citations for Anti F3 pAb (ATL-HPA069132) – 1 Found |
Rosell, Axel; Moser, Bernhard; Hisada, Yohei; Chinthapatla, Rukesh; Lian, Grace; Yang, Yi; Flick, Matthew J; Mackman, Nigel. Evaluation of different commercial antibodies for their ability to detect human and mouse tissue factor by western blotting. Research And Practice In Thrombosis And Haemostasis. 2020;4(6):1013-1023. PubMed |