Anti F3 pAb (ATL-HPA049292)
Atlas Antibodies
- Catalog No.:
- ATL-HPA049292-25
- Shipping:
- Calculated at Checkout
$351.00
Gene Name: F3
Alternative Gene Name: CD142
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028128: 55%, ENSRNOG00000011800: 54%
Entrez Gene ID: 2152
Uniprot ID: P13726
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | VKQTYLARVFSYPAGNVESTGSAGEPLYENSPEFTPYLETNLGQPTIQSFEQVGTKVNVTVEDERTLVRRNNTFLSLRDVFGKDLIYTLYYWKSSSSGKKTAKTNTNEFLIDVDKGEN |
| Gene Sequence | VKQTYLARVFSYPAGNVESTGSAGEPLYENSPEFTPYLETNLGQPTIQSFEQVGTKVNVTVEDERTLVRRNNTFLSLRDVFGKDLIYTLYYWKSSSSGKKTAKTNTNEFLIDVDKGEN |
| Gene ID - Mouse | ENSMUSG00000028128 |
| Gene ID - Rat | ENSRNOG00000011800 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti F3 pAb (ATL-HPA049292) | |
| Datasheet | Anti F3 pAb (ATL-HPA049292) Datasheet (External Link) |
| Vendor Page | Anti F3 pAb (ATL-HPA049292) at Atlas Antibodies |
| Documents & Links for Anti F3 pAb (ATL-HPA049292) | |
| Datasheet | Anti F3 pAb (ATL-HPA049292) Datasheet (External Link) |
| Vendor Page | Anti F3 pAb (ATL-HPA049292) |
| Citations for Anti F3 pAb (ATL-HPA049292) – 3 Found |
| Vessby, Johan; Lampinen, Maria; Åberg, Mikael; Rorsman, Fredrik; Siegbahn, Agneta; Wanders, Alkwin; Carlson, Marie. Tissue factor in ulcerative colitis, with and without concomitant primary sclerosing cholangitis. Upsala Journal Of Medical Sciences. 2019;124(4):238-245. PubMed |
| Rosell, Axel; Moser, Bernhard; Hisada, Yohei; Chinthapatla, Rukesh; Lian, Grace; Yang, Yi; Flick, Matthew J; Mackman, Nigel. Evaluation of different commercial antibodies for their ability to detect human and mouse tissue factor by western blotting. Research And Practice In Thrombosis And Haemostasis. 2020;4(6):1013-1023. PubMed |
| Fawkner-Corbett, David; Antanaviciute, Agne; Parikh, Kaushal; Jagielowicz, Marta; Gerós, Ana Sousa; Gupta, Tarun; Ashley, Neil; Khamis, Doran; Fowler, Darren; Morrissey, Edward; Cunningham, Chris; Johnson, Paul R V; Koohy, Hashem; Simmons, Alison. Spatiotemporal analysis of human intestinal development at single-cell resolution. Cell. 2021;184(3):810-826.e23. PubMed |