Anti F2RL3 pAb (ATL-HPA042340)

Atlas Antibodies

SKU: ATL-HPA042340-25

• 

Protein Description: F2R like thrombin or trypsin receptor 3
Gene Name: F2RL3
Alternative Gene Name: PAR4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000050147: 52%, ENSRNOG00000048186: 48%
Entrez Gene ID: 9002
Uniprot ID: Q96RI0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SAEFRDKVRAGLFQRSPGDTVASKASAEGGSRGMGTHSSLLQ
• Gene Sequence: SAEFRDKVRAGLFQRSPGDTVASKASAEGGSRGMGTHSSLLQ
• Gene ID - Mouse: ENSMUSG00000050147
• Gene ID - Rat: ENSRNOG00000048186
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.