Anti F2RL3 pAb (ATL-HPA042340)
Atlas Antibodies
- Catalog No.:
- ATL-HPA042340-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: F2RL3
Alternative Gene Name: PAR4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000050147: 52%, ENSRNOG00000048186: 48%
Entrez Gene ID: 9002
Uniprot ID: Q96RI0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | SAEFRDKVRAGLFQRSPGDTVASKASAEGGSRGMGTHSSLLQ |
Gene Sequence | SAEFRDKVRAGLFQRSPGDTVASKASAEGGSRGMGTHSSLLQ |
Gene ID - Mouse | ENSMUSG00000050147 |
Gene ID - Rat | ENSRNOG00000048186 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti F2RL3 pAb (ATL-HPA042340) | |
Datasheet | Anti F2RL3 pAb (ATL-HPA042340) Datasheet (External Link) |
Vendor Page | Anti F2RL3 pAb (ATL-HPA042340) at Atlas Antibodies |
Documents & Links for Anti F2RL3 pAb (ATL-HPA042340) | |
Datasheet | Anti F2RL3 pAb (ATL-HPA042340) Datasheet (External Link) |
Vendor Page | Anti F2RL3 pAb (ATL-HPA042340) |