Anti F2RL3 pAb (ATL-HPA042340)

Atlas Antibodies

Catalog No.:
ATL-HPA042340-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: F2R like thrombin or trypsin receptor 3
Gene Name: F2RL3
Alternative Gene Name: PAR4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000050147: 52%, ENSRNOG00000048186: 48%
Entrez Gene ID: 9002
Uniprot ID: Q96RI0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SAEFRDKVRAGLFQRSPGDTVASKASAEGGSRGMGTHSSLLQ
Gene Sequence SAEFRDKVRAGLFQRSPGDTVASKASAEGGSRGMGTHSSLLQ
Gene ID - Mouse ENSMUSG00000050147
Gene ID - Rat ENSRNOG00000048186
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti F2RL3 pAb (ATL-HPA042340)
Datasheet Anti F2RL3 pAb (ATL-HPA042340) Datasheet (External Link)
Vendor Page Anti F2RL3 pAb (ATL-HPA042340) at Atlas Antibodies

Documents & Links for Anti F2RL3 pAb (ATL-HPA042340)
Datasheet Anti F2RL3 pAb (ATL-HPA042340) Datasheet (External Link)
Vendor Page Anti F2RL3 pAb (ATL-HPA042340)