Anti F13A1 pAb (ATL-HPA001804 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA001804-25
Shipping:
Calculated at Checkout
$328.00
Adding to cart… The item has been added
Protein Description: coagulation factor XIII, A1 polypeptide
Gene Name: F13A1
Alternative Gene Name: F13A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039109: 87%, ENSRNOG00000015957: 87%
Entrez Gene ID: 2162
Uniprot ID: P00488
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LNVTSVHLFKERWDTNKVDHHTDKYENNKLIVRRGQSFYVQIDFSRPYDPRRDLFRVEYVIGRYPQENKGTYIPVPIVSELQSGKWGAKIVMREDRSVRLSIQSSPKCIVGKFRMYVAVWTPYGVLRTSRNPETDT
Gene Sequence LNVTSVHLFKERWDTNKVDHHTDKYENNKLIVRRGQSFYVQIDFSRPYDPRRDLFRVEYVIGRYPQENKGTYIPVPIVSELQSGKWGAKIVMREDRSVRLSIQSSPKCIVGKFRMYVAVWTPYGVLRTSRNPETDT
Gene ID - Mouse ENSMUSG00000039109
Gene ID - Rat ENSRNOG00000015957
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti F13A1 pAb (ATL-HPA001804 w/enhanced validation)
Datasheet Anti F13A1 pAb (ATL-HPA001804 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti F13A1 pAb (ATL-HPA001804 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti F13A1 pAb (ATL-HPA001804 w/enhanced validation)
Datasheet Anti F13A1 pAb (ATL-HPA001804 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti F13A1 pAb (ATL-HPA001804 w/enhanced validation)
Citations for Anti F13A1 pAb (ATL-HPA001804 w/enhanced validation) – 4 Found
Almgren, Peter; Lindqvist, Andreas; Krus, Ulrika; Hakaste, Liisa; Ottosson-Laakso, Emilia; Asplund, Olof; Sonestedt, Emily; Prasad, Rashmi B; Laurila, Esa; Orho-Melander, Marju; Melander, Olle; Tuomi, Tiinamaija; Holst, Jens Juul; Nilsson, Peter M; Wierup, Nils; Groop, Leif; Ahlqvist, Emma. Genetic determinants of circulating GIP and GLP-1 concentrations. Jci Insight. 2017;2(21)  PubMed
Kato, Bernet S; Nicholson, George; Neiman, Maja; Rantalainen, Mattias; Holmes, Chris C; Barrett, Amy; Uhlén, Mathias; Nilsson, Peter; Spector, Tim D; Schwenk, Jochen M. Variance decomposition of protein profiles from antibody arrays using a longitudinal twin model. Proteome Science. 2011;9( 22093360):73.  PubMed
Azimi, A; Pernemalm, M; Frostvik Stolt, M; Hansson, J; Lehtiö, J; Egyházi Brage, S; Hertzman Johansson, C. Proteomics analysis of melanoma metastases: association between S100A13 expression and chemotherapy resistance. British Journal Of Cancer. 2014;110(10):2489-95.  PubMed
Wang, Yutao; Yan, Kexin; Lin, Jiaxing; Li, Jun; Bi, Jianbin. Macrophage M2 Co-expression Factors Correlate With the Immune Microenvironment and Predict Outcome of Renal Clear Cell Carcinoma. Frontiers In Genetics. 12( 33692827):615655.  PubMed