Anti F11 pAb (ATL-HPA039808)

Atlas Antibodies

Catalog No.:
ATL-HPA039808-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: coagulation factor XI
Gene Name: F11
Alternative Gene Name: FXI
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031645: 73%, ENSRNOG00000013684: 75%
Entrez Gene ID: 2160
Uniprot ID: P03951
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SKALSGFSLQSCRHSIPVFCHSSFYHDTDFLGEELDIVAAKSHEACQKLCTNAVRCQFFTYTPAQASCNEGKGKCYLKLSSNGSPTKI
Gene Sequence SKALSGFSLQSCRHSIPVFCHSSFYHDTDFLGEELDIVAAKSHEACQKLCTNAVRCQFFTYTPAQASCNEGKGKCYLKLSSNGSPTKI
Gene ID - Mouse ENSMUSG00000031645
Gene ID - Rat ENSRNOG00000013684
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti F11 pAb (ATL-HPA039808)
Datasheet Anti F11 pAb (ATL-HPA039808) Datasheet (External Link)
Vendor Page Anti F11 pAb (ATL-HPA039808) at Atlas Antibodies

Documents & Links for Anti F11 pAb (ATL-HPA039808)
Datasheet Anti F11 pAb (ATL-HPA039808) Datasheet (External Link)
Vendor Page Anti F11 pAb (ATL-HPA039808)