Anti F11 pAb (ATL-HPA039808)
Atlas Antibodies
- Catalog No.:
- ATL-HPA039808-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: F11
Alternative Gene Name: FXI
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031645: 73%, ENSRNOG00000013684: 75%
Entrez Gene ID: 2160
Uniprot ID: P03951
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | SKALSGFSLQSCRHSIPVFCHSSFYHDTDFLGEELDIVAAKSHEACQKLCTNAVRCQFFTYTPAQASCNEGKGKCYLKLSSNGSPTKI |
Gene Sequence | SKALSGFSLQSCRHSIPVFCHSSFYHDTDFLGEELDIVAAKSHEACQKLCTNAVRCQFFTYTPAQASCNEGKGKCYLKLSSNGSPTKI |
Gene ID - Mouse | ENSMUSG00000031645 |
Gene ID - Rat | ENSRNOG00000013684 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti F11 pAb (ATL-HPA039808) | |
Datasheet | Anti F11 pAb (ATL-HPA039808) Datasheet (External Link) |
Vendor Page | Anti F11 pAb (ATL-HPA039808) at Atlas Antibodies |
Documents & Links for Anti F11 pAb (ATL-HPA039808) | |
Datasheet | Anti F11 pAb (ATL-HPA039808) Datasheet (External Link) |
Vendor Page | Anti F11 pAb (ATL-HPA039808) |