Anti EZH1 pAb (ATL-HPA077684)

Atlas Antibodies

Catalog No.:
ATL-HPA077684-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: enhancer of zeste 1 polycomb repressive complex 2 subunit
Gene Name: EZH1
Alternative Gene Name: KIAA0388, KMT6B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000006920: 96%, ENSRNOG00000020336: 92%
Entrez Gene ID: 2145
Uniprot ID: Q92800
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen YKRKNKEIKIEPEPCGTDCFLLLEGAKEYAMLHNPRSKCSGRRRRRHHIVSASCSNASASAVAETKEGDSDRDTGNDWASSSSE
Gene Sequence YKRKNKEIKIEPEPCGTDCFLLLEGAKEYAMLHNPRSKCSGRRRRRHHIVSASCSNASASAVAETKEGDSDRDTGNDWASSSSE
Gene ID - Mouse ENSMUSG00000006920
Gene ID - Rat ENSRNOG00000020336
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti EZH1 pAb (ATL-HPA077684)
Datasheet Anti EZH1 pAb (ATL-HPA077684) Datasheet (External Link)
Vendor Page Anti EZH1 pAb (ATL-HPA077684) at Atlas Antibodies

Documents & Links for Anti EZH1 pAb (ATL-HPA077684)
Datasheet Anti EZH1 pAb (ATL-HPA077684) Datasheet (External Link)
Vendor Page Anti EZH1 pAb (ATL-HPA077684)