Anti EYA3 pAb (ATL-HPA062889)

Atlas Antibodies

Catalog No.:
ATL-HPA062889-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: EYA transcriptional coactivator and phosphatase 3
Gene Name: EYA3
Alternative Gene Name: DKFZp686C132
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028886: 88%, ENSRNOG00000010396: 82%
Entrez Gene ID: 2140
Uniprot ID: Q99504
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ILGQNQYQACYPSSSFGVTGQTNSDAESTTLAATTYQSEKPSVMAPAPAAQRLSSG
Gene Sequence ILGQNQYQACYPSSSFGVTGQTNSDAESTTLAATTYQSEKPSVMAPAPAAQRLSSG
Gene ID - Mouse ENSMUSG00000028886
Gene ID - Rat ENSRNOG00000010396
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti EYA3 pAb (ATL-HPA062889)
Datasheet Anti EYA3 pAb (ATL-HPA062889) Datasheet (External Link)
Vendor Page Anti EYA3 pAb (ATL-HPA062889) at Atlas Antibodies

Documents & Links for Anti EYA3 pAb (ATL-HPA062889)
Datasheet Anti EYA3 pAb (ATL-HPA062889) Datasheet (External Link)
Vendor Page Anti EYA3 pAb (ATL-HPA062889)