Anti EYA3 pAb (ATL-HPA062889)

Atlas Antibodies

Catalog No.: ATL-HPA062889-25

Protein Description: EYA transcriptional coactivator and phosphatase 3
Gene Name: EYA3
Alternative Gene Name: DKFZp686C132
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028886: 88%, ENSRNOG00000010396: 82%
Entrez Gene ID: 2140
Uniprot ID: Q99504
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ILGQNQYQACYPSSSFGVTGQTNSDAESTTLAATTYQSEKPSVMAPAPAAQRLSSG
• Gene Sequence: ILGQNQYQACYPSSSFGVTGQTNSDAESTTLAATTYQSEKPSVMAPAPAAQRLSSG
• Gene ID - Mouse: ENSMUSG00000028886
• Gene ID - Rat: ENSRNOG00000010396
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.