Anti EYA2 pAb (ATL-HPA059291)
Atlas Antibodies
- Catalog No.:
- ATL-HPA059291-100
- Shipping:
- Calculated at Checkout
$638.00
Gene Name: EYA2
Alternative Gene Name: EAB1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000017897: 67%, ENSRNOG00000019203: 63%
Entrez Gene ID: 2139
Uniprot ID: O00167
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | MVELVISPSLTVNSDCLDKLKFNRADAAVWTLSDRQGITKSAPLRVSQLFSRSCPRVLPRQPSTAMAAYGQTQYSAGIQQATPYTAYPPPAQAYGIPSYSI |
| Gene Sequence | MVELVISPSLTVNSDCLDKLKFNRADAAVWTLSDRQGITKSAPLRVSQLFSRSCPRVLPRQPSTAMAAYGQTQYSAGIQQATPYTAYPPPAQAYGIPSYSI |
| Gene ID - Mouse | ENSMUSG00000017897 |
| Gene ID - Rat | ENSRNOG00000019203 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti EYA2 pAb (ATL-HPA059291) | |
| Datasheet | Anti EYA2 pAb (ATL-HPA059291) Datasheet (External Link) |
| Vendor Page | Anti EYA2 pAb (ATL-HPA059291) at Atlas Antibodies |
| Documents & Links for Anti EYA2 pAb (ATL-HPA059291) | |
| Datasheet | Anti EYA2 pAb (ATL-HPA059291) Datasheet (External Link) |
| Vendor Page | Anti EYA2 pAb (ATL-HPA059291) |