Anti EYA2 pAb (ATL-HPA059291)

Atlas Antibodies

Catalog No.: ATL-HPA059291-100

Protein Description: EYA transcriptional coactivator and phosphatase 2
Gene Name: EYA2
Alternative Gene Name: EAB1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000017897: 67%, ENSRNOG00000019203: 63%
Entrez Gene ID: 2139
Uniprot ID: O00167
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MVELVISPSLTVNSDCLDKLKFNRADAAVWTLSDRQGITKSAPLRVSQLFSRSCPRVLPRQPSTAMAAYGQTQYSAGIQQATPYTAYPPPAQAYGIPSYSI
• Gene Sequence: MVELVISPSLTVNSDCLDKLKFNRADAAVWTLSDRQGITKSAPLRVSQLFSRSCPRVLPRQPSTAMAAYGQTQYSAGIQQATPYTAYPPPAQAYGIPSYSI
• Gene ID - Mouse: ENSMUSG00000017897
• Gene ID - Rat: ENSRNOG00000019203
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.