Anti EYA2 pAb (ATL-HPA059291)

Atlas Antibodies

Catalog No.:
ATL-HPA059291-100
Shipping:
Calculated at Checkout
$596.00
Adding to cart… The item has been added
Protein Description: EYA transcriptional coactivator and phosphatase 2
Gene Name: EYA2
Alternative Gene Name: EAB1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000017897: 67%, ENSRNOG00000019203: 63%
Entrez Gene ID: 2139
Uniprot ID: O00167
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MVELVISPSLTVNSDCLDKLKFNRADAAVWTLSDRQGITKSAPLRVSQLFSRSCPRVLPRQPSTAMAAYGQTQYSAGIQQATPYTAYPPPAQAYGIPSYSI
Gene Sequence MVELVISPSLTVNSDCLDKLKFNRADAAVWTLSDRQGITKSAPLRVSQLFSRSCPRVLPRQPSTAMAAYGQTQYSAGIQQATPYTAYPPPAQAYGIPSYSI
Gene ID - Mouse ENSMUSG00000017897
Gene ID - Rat ENSRNOG00000019203
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti EYA2 pAb (ATL-HPA059291)
Datasheet Anti EYA2 pAb (ATL-HPA059291) Datasheet (External Link)
Vendor Page Anti EYA2 pAb (ATL-HPA059291) at Atlas Antibodies

Documents & Links for Anti EYA2 pAb (ATL-HPA059291)
Datasheet Anti EYA2 pAb (ATL-HPA059291) Datasheet (External Link)
Vendor Page Anti EYA2 pAb (ATL-HPA059291)