Anti EXTL2 pAb (ATL-HPA068921)

Atlas Antibodies

Catalog No.:
ATL-HPA068921-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: exostosin-like glycosyltransferase 2
Gene Name: EXTL2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027963: 89%, ENSRNOG00000014323: 90%
Entrez Gene ID: 2135
Uniprot ID: Q9UBQ6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TANRMRNRLQVFPELETNAVLMVDDDTLISTPDLVFAFSVWQQFPDQIVGFVPRKHVSTSSGIYSYGSFEM
Gene Sequence TANRMRNRLQVFPELETNAVLMVDDDTLISTPDLVFAFSVWQQFPDQIVGFVPRKHVSTSSGIYSYGSFEM
Gene ID - Mouse ENSMUSG00000027963
Gene ID - Rat ENSRNOG00000014323
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti EXTL2 pAb (ATL-HPA068921)
Datasheet Anti EXTL2 pAb (ATL-HPA068921) Datasheet (External Link)
Vendor Page Anti EXTL2 pAb (ATL-HPA068921) at Atlas Antibodies

Documents & Links for Anti EXTL2 pAb (ATL-HPA068921)
Datasheet Anti EXTL2 pAb (ATL-HPA068921) Datasheet (External Link)
Vendor Page Anti EXTL2 pAb (ATL-HPA068921)