Anti EXOSC7 pAb (ATL-HPA057980)

Atlas Antibodies

Catalog No.:
ATL-HPA057980-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: exosome component 7
Gene Name: EXOSC7
Alternative Gene Name: EAP1, hRrp42p, KIAA0116, p8, RRP42, Rrp42p
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025785: 99%, ENSRNOG00000060337: 97%
Entrez Gene ID: 23016
Uniprot ID: Q15024
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EDLRVDGRGCEDYRCVEVETDVVSNTSGSARVKLGHTDILVGVKAEMGTPKLEKPNEGYLEFFVDCSASATPEFEGRGGDDLGTEIANTLYRI
Gene Sequence EDLRVDGRGCEDYRCVEVETDVVSNTSGSARVKLGHTDILVGVKAEMGTPKLEKPNEGYLEFFVDCSASATPEFEGRGGDDLGTEIANTLYRI
Gene ID - Mouse ENSMUSG00000025785
Gene ID - Rat ENSRNOG00000060337
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti EXOSC7 pAb (ATL-HPA057980)
Datasheet Anti EXOSC7 pAb (ATL-HPA057980) Datasheet (External Link)
Vendor Page Anti EXOSC7 pAb (ATL-HPA057980) at Atlas Antibodies

Documents & Links for Anti EXOSC7 pAb (ATL-HPA057980)
Datasheet Anti EXOSC7 pAb (ATL-HPA057980) Datasheet (External Link)
Vendor Page Anti EXOSC7 pAb (ATL-HPA057980)