Anti EXOSC4 pAb (ATL-HPA065103)

Atlas Antibodies

Catalog No.:
ATL-HPA065103-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: exosome component 4
Gene Name: EXOSC4
Alternative Gene Name: FLJ20591, hRrp41p, p12A, RRP41, RRP41A, Rrp41p, SKI6, Ski6p
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034259: 99%, ENSRNOG00000012348: 99%
Entrez Gene ID: 54512
Uniprot ID: Q9NPD3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PHGDRKSCEMGLQLRQTFEAAILTQLHPRSQIDIYVQVLQADGGTYAACVNAATLAVLDAGIPMRDFVCACSA
Gene Sequence PHGDRKSCEMGLQLRQTFEAAILTQLHPRSQIDIYVQVLQADGGTYAACVNAATLAVLDAGIPMRDFVCACSA
Gene ID - Mouse ENSMUSG00000034259
Gene ID - Rat ENSRNOG00000012348
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti EXOSC4 pAb (ATL-HPA065103)
Datasheet Anti EXOSC4 pAb (ATL-HPA065103) Datasheet (External Link)
Vendor Page Anti EXOSC4 pAb (ATL-HPA065103) at Atlas Antibodies

Documents & Links for Anti EXOSC4 pAb (ATL-HPA065103)
Datasheet Anti EXOSC4 pAb (ATL-HPA065103) Datasheet (External Link)
Vendor Page Anti EXOSC4 pAb (ATL-HPA065103)