Anti EXOSC3 pAb (ATL-HPA020485 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA020485-25
  • Immunohistochemical staining of human tonsil shows moderate to strong nuclear positivity in non-germinal and germinal center cells.
  • Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm.
  • Western blot analysis in control (vector only transfected HEK293T lysate) and EXOSC3 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY414229).
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: exosome component 3
Gene Name: EXOSC3
Alternative Gene Name: CGI-102, hRrp-40, hRrp40p, p10, RRP40, Rrp40p
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028322: 96%, ENSRNOG00000012409: 96%
Entrez Gene ID: 51010
Uniprot ID: Q9NQT5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VYWVDSQQKRYVPVKGDHVIGIVTAKSGDIFKVDVGGSEPASLSYLSFEGATKRNRPNVQVGDLIYGQFVVANKD
Gene Sequence VYWVDSQQKRYVPVKGDHVIGIVTAKSGDIFKVDVGGSEPASLSYLSFEGATKRNRPNVQVGDLIYGQFVVANKD
Gene ID - Mouse ENSMUSG00000028322
Gene ID - Rat ENSRNOG00000012409
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.



Documents & Links for Anti EXOSC3 pAb (ATL-HPA020485 w/enhanced validation)
Datasheet Anti EXOSC3 pAb (ATL-HPA020485 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti EXOSC3 pAb (ATL-HPA020485 w/enhanced validation)