Anti EXOSC1 pAb (ATL-HPA038370)

Atlas Antibodies

Catalog No.:
ATL-HPA038370-100
Shipping:
Calculated at Checkout
$596.00
Adding to cart… The item has been added
Protein Description: exosome component 1
Gene Name: EXOSC1
Alternative Gene Name: CGI-108, CSL4, Csl4p, hCsl4p, p13, SKI4, Ski4p
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034321: 94%, ENSRNOG00000048708: 94%
Entrez Gene ID: 51013
Uniprot ID: Q9Y3B2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human, Mouse, Rat
Clonality Polyclonal
Host Rabbit
Immunogen APPVRYCIPGERLCNLEEGSPGSGTYTRHGYIFSSLAGCLMKSSENGALPVVSVVRETESQLLPDVGAIVTCKVSSINSRFAKVHILYVGSMPLKNS
Gene Sequence APPVRYCIPGERLCNLEEGSPGSGTYTRHGYIFSSLAGCLMKSSENGALPVVSVVRETESQLLPDVGAIVTCKVSSINSRFAKVHILYVGSMPLKNS
Gene ID - Mouse ENSMUSG00000034321
Gene ID - Rat ENSRNOG00000048708
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti EXOSC1 pAb (ATL-HPA038370)
Datasheet Anti EXOSC1 pAb (ATL-HPA038370) Datasheet (External Link)
Vendor Page Anti EXOSC1 pAb (ATL-HPA038370) at Atlas Antibodies

Documents & Links for Anti EXOSC1 pAb (ATL-HPA038370)
Datasheet Anti EXOSC1 pAb (ATL-HPA038370) Datasheet (External Link)
Vendor Page Anti EXOSC1 pAb (ATL-HPA038370)