Anti EXOC8 pAb (ATL-HPA027438 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA027438-25
  • Immunohistochemical staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.
  • Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol.
  • Western blot analysis in control (vector only transfected HEK293T lysate) and eXOC8 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY406195).
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: exocyst complex component 8
Gene Name: EXOC8
Alternative Gene Name: EXO84, Exo84p, SEC84
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000074030: 85%, ENSRNOG00000019766: 84%
Entrez Gene ID: 149371
Uniprot ID: Q8IYI6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RDHLRGQAGFFSTPGGASRDGSGPGEEGKQRTLTTLLEKVEGCRHLLETPGQYLVYNGDLVEYDADHMAQLQRVHGFLMNDCLLVATWLPQRRGMYRYNAL
Gene Sequence RDHLRGQAGFFSTPGGASRDGSGPGEEGKQRTLTTLLEKVEGCRHLLETPGQYLVYNGDLVEYDADHMAQLQRVHGFLMNDCLLVATWLPQRRGMYRYNAL
Gene ID - Mouse ENSMUSG00000074030
Gene ID - Rat ENSRNOG00000019766
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti EXOC8 pAb (ATL-HPA027438 w/enhanced validation)
Datasheet Anti EXOC8 pAb (ATL-HPA027438 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti EXOC8 pAb (ATL-HPA027438 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti EXOC8 pAb (ATL-HPA027438 w/enhanced validation)
Datasheet Anti EXOC8 pAb (ATL-HPA027438 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti EXOC8 pAb (ATL-HPA027438 w/enhanced validation)