Anti EXOC6B pAb (ATL-HPA063991)
Atlas Antibodies
- Catalog No.:
- ATL-HPA063991-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: EXOC6B
Alternative Gene Name: KIAA0919, SEC15B, SEC15L2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033769: 80%, ENSRNOG00000059615: 78%
Entrez Gene ID: 23233
Uniprot ID: Q9Y2D4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | TNLNQKIDQFLQLADYDWMTGDLGNKASDYLVDLIAFLRSTFAVFTHLPVSGSCYFVLYI |
Gene Sequence | TNLNQKIDQFLQLADYDWMTGDLGNKASDYLVDLIAFLRSTFAVFTHLPVSGSCYFVLYI |
Gene ID - Mouse | ENSMUSG00000033769 |
Gene ID - Rat | ENSRNOG00000059615 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti EXOC6B pAb (ATL-HPA063991) | |
Datasheet | Anti EXOC6B pAb (ATL-HPA063991) Datasheet (External Link) |
Vendor Page | Anti EXOC6B pAb (ATL-HPA063991) at Atlas Antibodies |
Documents & Links for Anti EXOC6B pAb (ATL-HPA063991) | |
Datasheet | Anti EXOC6B pAb (ATL-HPA063991) Datasheet (External Link) |
Vendor Page | Anti EXOC6B pAb (ATL-HPA063991) |