Anti EXOC6B pAb (ATL-HPA063991)

Atlas Antibodies

Catalog No.:
ATL-HPA063991-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: exocyst complex component 6B
Gene Name: EXOC6B
Alternative Gene Name: KIAA0919, SEC15B, SEC15L2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033769: 80%, ENSRNOG00000059615: 78%
Entrez Gene ID: 23233
Uniprot ID: Q9Y2D4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TNLNQKIDQFLQLADYDWMTGDLGNKASDYLVDLIAFLRSTFAVFTHLPVSGSCYFVLYI
Gene Sequence TNLNQKIDQFLQLADYDWMTGDLGNKASDYLVDLIAFLRSTFAVFTHLPVSGSCYFVLYI
Gene ID - Mouse ENSMUSG00000033769
Gene ID - Rat ENSRNOG00000059615
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti EXOC6B pAb (ATL-HPA063991)
Datasheet Anti EXOC6B pAb (ATL-HPA063991) Datasheet (External Link)
Vendor Page Anti EXOC6B pAb (ATL-HPA063991) at Atlas Antibodies

Documents & Links for Anti EXOC6B pAb (ATL-HPA063991)
Datasheet Anti EXOC6B pAb (ATL-HPA063991) Datasheet (External Link)
Vendor Page Anti EXOC6B pAb (ATL-HPA063991)