Anti EXOC6 pAb (ATL-HPA059111)

Atlas Antibodies

SKU:
ATL-HPA059111-25
  • Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & vesicles.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: exocyst complex component 6
Gene Name: EXOC6
Alternative Gene Name: DKFZp761I2124, EXOC6A, FLJ1125, MGC33397, SEC15L, SEC15L1, Sec15p
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000053799: 90%, ENSRNOG00000036601: 86%
Entrez Gene ID: 54536
Uniprot ID: Q8TAG9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LKEQMSAKRYYSALKTMEQLENVYFPWVSQYRFCQLMIENLPKLREDIKEI
Gene Sequence LKEQMSAKRYYSALKTMEQLENVYFPWVSQYRFCQLMIENLPKLREDIKEI
Gene ID - Mouse ENSMUSG00000053799
Gene ID - Rat ENSRNOG00000036601
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti EXOC6 pAb (ATL-HPA059111)
Datasheet Anti EXOC6 pAb (ATL-HPA059111) Datasheet (External Link)
Vendor Page Anti EXOC6 pAb (ATL-HPA059111) at Atlas Antibodies

Documents & Links for Anti EXOC6 pAb (ATL-HPA059111)
Datasheet Anti EXOC6 pAb (ATL-HPA059111) Datasheet (External Link)
Vendor Page Anti EXOC6 pAb (ATL-HPA059111)