Anti EXOC4 pAb (ATL-HPA031444)

Atlas Antibodies

SKU:
ATL-HPA031444-25
  • Immunofluorescent staining of human cell line A-431 shows localization to nucleus & nucleoli.
  • Western blot analysis in human cell line RT-4 and human cell line U-251 MG.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: exocyst complex component 4
Gene Name: EXOC4
Alternative Gene Name: KIAA1699, MGC27170, SEC8, SEC8L1, Sec8p
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029763: 97%, ENSRNOG00000046023: 96%
Entrez Gene ID: 60412
Uniprot ID: Q96A65
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen AKQCPLREFLTVYIKNIFLNQVLAEINKEIEGVTKTSDPLKILANADTMKVLGVQRPLLQSTIIVEKTVQDLLNLMHDLSAYSDQFLNMVCVKLQEYKDTCTAAYRGIVQSEEKLVISASWAKDDDISRLLKSLPNWMNMAQPK
Gene Sequence AKQCPLREFLTVYIKNIFLNQVLAEINKEIEGVTKTSDPLKILANADTMKVLGVQRPLLQSTIIVEKTVQDLLNLMHDLSAYSDQFLNMVCVKLQEYKDTCTAAYRGIVQSEEKLVISASWAKDDDISRLLKSLPNWMNMAQPK
Gene ID - Mouse ENSMUSG00000029763
Gene ID - Rat ENSRNOG00000046023
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti EXOC4 pAb (ATL-HPA031444)
Datasheet Anti EXOC4 pAb (ATL-HPA031444) Datasheet (External Link)
Vendor Page Anti EXOC4 pAb (ATL-HPA031444) at Atlas Antibodies

Documents & Links for Anti EXOC4 pAb (ATL-HPA031444)
Datasheet Anti EXOC4 pAb (ATL-HPA031444) Datasheet (External Link)
Vendor Page Anti EXOC4 pAb (ATL-HPA031444)