Anti EXOC4 pAb (ATL-HPA031443)

Atlas Antibodies

SKU:
ATL-HPA031443-25
  • Immunohistochemical staining of human fallopian tube shows moderate cytoplasmic positivity in glandular cells.
  • Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoli.
  • Western blot analysis in human cell line CAPAN-2.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: exocyst complex component 4
Gene Name: EXOC4
Alternative Gene Name: KIAA1699, MGC27170, SEC8, SEC8L1, Sec8p
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029763: 99%, ENSRNOG00000046023: 99%
Entrez Gene ID: 60412
Uniprot ID: Q96A65
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QHKFQYIFEGLGHLISCILINGAQYFRRISESGIKKMCRNIFVLQQNLTNITMSREADLDFARQYYEMLYNTADELLNLVVDQGVKYTELEYIHALTLLHRSQTGVGELTTQNTRLQRLKEIICEQAAIKQATKD
Gene Sequence QHKFQYIFEGLGHLISCILINGAQYFRRISESGIKKMCRNIFVLQQNLTNITMSREADLDFARQYYEMLYNTADELLNLVVDQGVKYTELEYIHALTLLHRSQTGVGELTTQNTRLQRLKEIICEQAAIKQATKD
Gene ID - Mouse ENSMUSG00000029763
Gene ID - Rat ENSRNOG00000046023
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti EXOC4 pAb (ATL-HPA031443)
Datasheet Anti EXOC4 pAb (ATL-HPA031443) Datasheet (External Link)
Vendor Page Anti EXOC4 pAb (ATL-HPA031443) at Atlas Antibodies

Documents & Links for Anti EXOC4 pAb (ATL-HPA031443)
Datasheet Anti EXOC4 pAb (ATL-HPA031443) Datasheet (External Link)
Vendor Page Anti EXOC4 pAb (ATL-HPA031443)



Citations for Anti EXOC4 pAb (ATL-HPA031443) – 1 Found
Stadler, Charlotte; Rexhepaj, Elton; Singan, Vasanth R; Murphy, Robert F; Pepperkok, Rainer; Uhlén, Mathias; Simpson, Jeremy C; Lundberg, Emma. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nature Methods. 2013;10(4):315-23.  PubMed