Anti EXOC3L1 pAb (ATL-HPA029574)

Atlas Antibodies

SKU:
ATL-HPA029574-25
  • Immunohistochemical staining of human kidney shows strong cytoplasmic positivity in cells in tubules.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: exocyst complex component 3-like 1
Gene Name: EXOC3L1
Alternative Gene Name: EXOC3L, FLJ35539, FLJ35587
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000043251: 77%, ENSRNOG00000015641: 78%
Entrez Gene ID: 283849
Uniprot ID: Q86VI1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MGSLELGPEADVSQLEPLLTLENIEQLEATFVANIQASVSQWLQNALDGEVAEWGREHGPNTDPSGSYYSPMPAIVLQILEENIRVASLVSESLQQRVHGMALSELGTFLRSFSDALIRFSRDHFRGKSMAPHYVPYL
Gene Sequence MGSLELGPEADVSQLEPLLTLENIEQLEATFVANIQASVSQWLQNALDGEVAEWGREHGPNTDPSGSYYSPMPAIVLQILEENIRVASLVSESLQQRVHGMALSELGTFLRSFSDALIRFSRDHFRGKSMAPHYVPYL
Gene ID - Mouse ENSMUSG00000043251
Gene ID - Rat ENSRNOG00000015641
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti EXOC3L1 pAb (ATL-HPA029574)
Datasheet Anti EXOC3L1 pAb (ATL-HPA029574) Datasheet (External Link)
Vendor Page Anti EXOC3L1 pAb (ATL-HPA029574) at Atlas Antibodies

Documents & Links for Anti EXOC3L1 pAb (ATL-HPA029574)
Datasheet Anti EXOC3L1 pAb (ATL-HPA029574) Datasheet (External Link)
Vendor Page Anti EXOC3L1 pAb (ATL-HPA029574)