Anti EXOC3 pAb (ATL-HPA037880)

Atlas Antibodies

SKU:
ATL-HPA037880-25
  • Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm & mitochondria.
  • Western blot analysis in human cell line RT-4.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: exocyst complex component 3
Gene Name: EXOC3
Alternative Gene Name: SEC6L1, Sec6p
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034152: 98%, ENSRNOG00000039776: 98%
Entrez Gene ID: 11336
Uniprot ID: O60645
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VENLKNIFSVPEIVRETQDLIEQGALLQAHRKLMDLECSRDGLMYEQYRMDSGNTRDMTLIHGYFGSTQGLSDELAKQLWMV
Gene Sequence VENLKNIFSVPEIVRETQDLIEQGALLQAHRKLMDLECSRDGLMYEQYRMDSGNTRDMTLIHGYFGSTQGLSDELAKQLWMV
Gene ID - Mouse ENSMUSG00000034152
Gene ID - Rat ENSRNOG00000039776
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti EXOC3 pAb (ATL-HPA037880)
Datasheet Anti EXOC3 pAb (ATL-HPA037880) Datasheet (External Link)
Vendor Page Anti EXOC3 pAb (ATL-HPA037880) at Atlas Antibodies

Documents & Links for Anti EXOC3 pAb (ATL-HPA037880)
Datasheet Anti EXOC3 pAb (ATL-HPA037880) Datasheet (External Link)
Vendor Page Anti EXOC3 pAb (ATL-HPA037880)