Anti EXOC2 pAb (ATL-HPA032093)

Atlas Antibodies

SKU:
ATL-HPA032093-25
  • Immunofluorescent staining of human cell line U-251 MG shows positivity in vesicles.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: exocyst complex component 2
Gene Name: EXOC2
Alternative Gene Name: FLJ11026, SEC5L1, Sec5p
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021357: 93%, ENSRNOG00000060266: 94%
Entrez Gene ID: 55770
Uniprot ID: Q96KP1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen IIVTTKSGGRGTSTVSFKLLKPEKIGILDQSAVWVDEMNYYDMRTDRNKGIPPLSLRPANPLGIEIEKSKFSQKDLEMLFHGMSADFTS
Gene Sequence IIVTTKSGGRGTSTVSFKLLKPEKIGILDQSAVWVDEMNYYDMRTDRNKGIPPLSLRPANPLGIEIEKSKFSQKDLEMLFHGMSADFTS
Gene ID - Mouse ENSMUSG00000021357
Gene ID - Rat ENSRNOG00000060266
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti EXOC2 pAb (ATL-HPA032093)
Datasheet Anti EXOC2 pAb (ATL-HPA032093) Datasheet (External Link)
Vendor Page Anti EXOC2 pAb (ATL-HPA032093) at Atlas Antibodies

Documents & Links for Anti EXOC2 pAb (ATL-HPA032093)
Datasheet Anti EXOC2 pAb (ATL-HPA032093) Datasheet (External Link)
Vendor Page Anti EXOC2 pAb (ATL-HPA032093)



Citations for Anti EXOC2 pAb (ATL-HPA032093) – 1 Found
Yang, Long; Gu, Wenwen; Cheung, King-Ho; Yan, Lan; Tong, Benjamin Chun-Kit; Jiang, Yuanying; Yang, Jun. InsP(3)R-SEC5 interaction on phagosomes modulates innate immunity to Candida albicans by promoting cytosolic Ca(2+) elevation and TBK1 activity. Bmc Biology. 2018;16(1):46.  PubMed