Anti EXOC2 pAb (ATL-HPA032093)
Atlas Antibodies
- Catalog No.:
- ATL-HPA032093-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: EXOC2
Alternative Gene Name: FLJ11026, SEC5L1, Sec5p
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021357: 93%, ENSRNOG00000060266: 94%
Entrez Gene ID: 55770
Uniprot ID: Q96KP1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | IIVTTKSGGRGTSTVSFKLLKPEKIGILDQSAVWVDEMNYYDMRTDRNKGIPPLSLRPANPLGIEIEKSKFSQKDLEMLFHGMSADFTS |
Gene Sequence | IIVTTKSGGRGTSTVSFKLLKPEKIGILDQSAVWVDEMNYYDMRTDRNKGIPPLSLRPANPLGIEIEKSKFSQKDLEMLFHGMSADFTS |
Gene ID - Mouse | ENSMUSG00000021357 |
Gene ID - Rat | ENSRNOG00000060266 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti EXOC2 pAb (ATL-HPA032093) | |
Datasheet | Anti EXOC2 pAb (ATL-HPA032093) Datasheet (External Link) |
Vendor Page | Anti EXOC2 pAb (ATL-HPA032093) at Atlas Antibodies |
Documents & Links for Anti EXOC2 pAb (ATL-HPA032093) | |
Datasheet | Anti EXOC2 pAb (ATL-HPA032093) Datasheet (External Link) |
Vendor Page | Anti EXOC2 pAb (ATL-HPA032093) |
Citations for Anti EXOC2 pAb (ATL-HPA032093) – 1 Found |
Yang, Long; Gu, Wenwen; Cheung, King-Ho; Yan, Lan; Tong, Benjamin Chun-Kit; Jiang, Yuanying; Yang, Jun. InsP(3)R-SEC5 interaction on phagosomes modulates innate immunity to Candida albicans by promoting cytosolic Ca(2+) elevation and TBK1 activity. Bmc Biology. 2018;16(1):46. PubMed |