Anti EXD3 pAb (ATL-HPA047395)

Atlas Antibodies

SKU:
ATL-HPA047395-25
  • Immunohistochemical staining of human stomach (upper) shows strong cytoplasmic positivity in glandular cells.
  • Immunofluorescent staining of human cell line U-2 OS shows localization to actin filaments & focal adhesion sites.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: exonuclease 3'-5' domain containing 3
Gene Name: EXD3
Alternative Gene Name: FLJ20433, LOC54932, mut-7
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000023047: 24%, ENSRNOG00000018804: 24%
Entrez Gene ID: 54932
Uniprot ID: Q8N9H8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FAALDDPLAGLLDMLESCRGQRGEGPSLAAWISHQLQCWLQAQPCPSLAQHSLRLKQLQARVVKVLTESPPSLAAPLASIFQLQDADRSCLLAHVHR
Gene Sequence FAALDDPLAGLLDMLESCRGQRGEGPSLAAWISHQLQCWLQAQPCPSLAQHSLRLKQLQARVVKVLTESPPSLAAPLASIFQLQDADRSCLLAHVHR
Gene ID - Mouse ENSMUSG00000023047
Gene ID - Rat ENSRNOG00000018804
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti EXD3 pAb (ATL-HPA047395)
Datasheet Anti EXD3 pAb (ATL-HPA047395) Datasheet (External Link)
Vendor Page Anti EXD3 pAb (ATL-HPA047395) at Atlas Antibodies

Documents & Links for Anti EXD3 pAb (ATL-HPA047395)
Datasheet Anti EXD3 pAb (ATL-HPA047395) Datasheet (External Link)
Vendor Page Anti EXD3 pAb (ATL-HPA047395)