Anti EXD2 pAb (ATL-HPA005848)
Atlas Antibodies
- Catalog No.:
- ATL-HPA005848-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: EXD2
Alternative Gene Name: C14orf114, EXDL2, FLJ10738
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032705: 90%, ENSRNOG00000027707: 92%
Entrez Gene ID: 55218
Uniprot ID: Q9NVH0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC, IHC |
Reactivity | Human, Mouse |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | TSCHAISNYYDNHLKQQLAKEFQAPIGSEEGLRLLEDPERRQVRSGARALLNAESLPTQRKEELLQALREFYNTDVVTEEMLQEAASLETRISNENYVPHGLKVVQCH |
Gene Sequence | TSCHAISNYYDNHLKQQLAKEFQAPIGSEEGLRLLEDPERRQVRSGARALLNAESLPTQRKEELLQALREFYNTDVVTEEMLQEAASLETRISNENYVPHGLKVVQCH |
Gene ID - Mouse | ENSMUSG00000032705 |
Gene ID - Rat | ENSRNOG00000027707 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti EXD2 pAb (ATL-HPA005848) | |
Datasheet | Anti EXD2 pAb (ATL-HPA005848) Datasheet (External Link) |
Vendor Page | Anti EXD2 pAb (ATL-HPA005848) at Atlas Antibodies |
Documents & Links for Anti EXD2 pAb (ATL-HPA005848) | |
Datasheet | Anti EXD2 pAb (ATL-HPA005848) Datasheet (External Link) |
Vendor Page | Anti EXD2 pAb (ATL-HPA005848) |
Citations for Anti EXD2 pAb (ATL-HPA005848) – 5 Found |
Biehs, Ronja; Steinlage, Monika; Barton, Olivia; Juhász, Szilvia; Künzel, Julia; Spies, Julian; Shibata, Atsushi; Jeggo, Penny A; Löbrich, Markus. DNA Double-Strand Break Resection Occurs during Non-homologous End Joining in G1 but Is Distinct from Resection during Homologous Recombination. Molecular Cell. 2017;65(4):671-684.e5. PubMed |
Hensen, Fenna; Moretton, Amandine; van Esveld, Selma; Farge, Géraldine; Spelbrink, Johannes N. The mitochondrial outer-membrane location of the EXD2 exonuclease contradicts its direct role in nuclear DNA repair. Scientific Reports. 2018;8(1):5368. PubMed |
Nieminuszczy, Jadwiga; Broderick, Ronan; Bellani, Marina A; Smethurst, Elizabeth; Schwab, Rebekka A; Cherdyntseva, Veronica; Evmorfopoulou, Theodora; Lin, Yea-Lih; Minczuk, Michal; Pasero, Philippe; Gagos, Sarantis; Seidman, Michael M; Niedzwiedz, Wojciech. EXD2 Protects Stressed Replication Forks and Is Required for Cell Viability in the Absence of BRCA1/2. Molecular Cell. 2019;75(3):605-619.e6. PubMed |
Sandoz, Jérémy; Cigrang, Max; Zachayus, Amélie; Catez, Philippe; Donnio, Lise-Marie; Elly, Clèmence; Nieminuszczy, Jadwiga; Berico, Pietro; Braun, Cathy; Alekseev, Sergey; Egly, Jean-Marc; Niedzwiedz, Wojciech; Giglia-Mari, Giuseppina; Compe, Emmanuel; Coin, Frédéric. Active mRNA degradation by EXD2 nuclease elicits recovery of transcription after genotoxic stress. Nature Communications. 2023;14(1):341. PubMed |
Qin, Wei; Myers, Samuel A; Carey, Dominique K; Carr, Steven A; Ting, Alice Y. Spatiotemporally-resolved mapping of RNA binding proteins via functional proximity labeling reveals a mitochondrial mRNA anchor promoting stress recovery. Nature Communications. 2021;12(1):4980. PubMed |