Anti EXD2 pAb (ATL-HPA002906)

Atlas Antibodies

Catalog No.:
ATL-HPA002906-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: exonuclease 3'-5' domain containing 2
Gene Name: EXD2
Alternative Gene Name: C14orf114, EXDL2, FLJ10738
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032705: 60%, ENSRNOG00000027707: 58%
Entrez Gene ID: 55218
Uniprot ID: Q9NVH0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SKTSPVTQQPQQKVLGSRELPPPEDDQLHSSAPRSSWKERILKAKVVTVSQEAEWDQIEPLLRSELEDFPVLGIDCEWERHGTYLQWLF
Gene Sequence SKTSPVTQQPQQKVLGSRELPPPEDDQLHSSAPRSSWKERILKAKVVTVSQEAEWDQIEPLLRSELEDFPVLGIDCEWERHGTYLQWLF
Gene ID - Mouse ENSMUSG00000032705
Gene ID - Rat ENSRNOG00000027707
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti EXD2 pAb (ATL-HPA002906)
Datasheet Anti EXD2 pAb (ATL-HPA002906) Datasheet (External Link)
Vendor Page Anti EXD2 pAb (ATL-HPA002906) at Atlas Antibodies

Documents & Links for Anti EXD2 pAb (ATL-HPA002906)
Datasheet Anti EXD2 pAb (ATL-HPA002906) Datasheet (External Link)
Vendor Page Anti EXD2 pAb (ATL-HPA002906)