Anti EVX2 pAb (ATL-HPA041576)

Atlas Antibodies

Catalog No.:
ATL-HPA041576-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: even-skipped homeobox 2
Gene Name: EVX2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000001815: 86%, ENSRNOG00000001589: 86%
Entrez Gene ID: 344191
Uniprot ID: Q03828
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PLHSALGELPAKGKFEIDTLFNLQHTGSESTVSSEISSAAESRKKPGHYS
Gene Sequence PLHSALGELPAKGKFEIDTLFNLQHTGSESTVSSEISSAAESRKKPGHYS
Gene ID - Mouse ENSMUSG00000001815
Gene ID - Rat ENSRNOG00000001589
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti EVX2 pAb (ATL-HPA041576)
Datasheet Anti EVX2 pAb (ATL-HPA041576) Datasheet (External Link)
Vendor Page Anti EVX2 pAb (ATL-HPA041576) at Atlas Antibodies

Documents & Links for Anti EVX2 pAb (ATL-HPA041576)
Datasheet Anti EVX2 pAb (ATL-HPA041576) Datasheet (External Link)
Vendor Page Anti EVX2 pAb (ATL-HPA041576)