Anti EVX2 pAb (ATL-HPA041576)
Atlas Antibodies
- Catalog No.:
- ATL-HPA041576-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: EVX2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000001815: 86%, ENSRNOG00000001589: 86%
Entrez Gene ID: 344191
Uniprot ID: Q03828
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC, ChIP |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | PLHSALGELPAKGKFEIDTLFNLQHTGSESTVSSEISSAAESRKKPGHYS |
| Gene Sequence | PLHSALGELPAKGKFEIDTLFNLQHTGSESTVSSEISSAAESRKKPGHYS |
| Gene ID - Mouse | ENSMUSG00000001815 |
| Gene ID - Rat | ENSRNOG00000001589 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti EVX2 pAb (ATL-HPA041576) | |
| Datasheet | Anti EVX2 pAb (ATL-HPA041576) Datasheet (External Link) |
| Vendor Page | Anti EVX2 pAb (ATL-HPA041576) at Atlas Antibodies |
| Documents & Links for Anti EVX2 pAb (ATL-HPA041576) | |
| Datasheet | Anti EVX2 pAb (ATL-HPA041576) Datasheet (External Link) |
| Vendor Page | Anti EVX2 pAb (ATL-HPA041576) |