Anti EVX2 pAb (ATL-HPA041576)
Atlas Antibodies
- Catalog No.:
- ATL-HPA041576-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: EVX2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000001815: 86%, ENSRNOG00000001589: 86%
Entrez Gene ID: 344191
Uniprot ID: Q03828
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | PLHSALGELPAKGKFEIDTLFNLQHTGSESTVSSEISSAAESRKKPGHYS |
Gene Sequence | PLHSALGELPAKGKFEIDTLFNLQHTGSESTVSSEISSAAESRKKPGHYS |
Gene ID - Mouse | ENSMUSG00000001815 |
Gene ID - Rat | ENSRNOG00000001589 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti EVX2 pAb (ATL-HPA041576) | |
Datasheet | Anti EVX2 pAb (ATL-HPA041576) Datasheet (External Link) |
Vendor Page | Anti EVX2 pAb (ATL-HPA041576) at Atlas Antibodies |
Documents & Links for Anti EVX2 pAb (ATL-HPA041576) | |
Datasheet | Anti EVX2 pAb (ATL-HPA041576) Datasheet (External Link) |
Vendor Page | Anti EVX2 pAb (ATL-HPA041576) |