Anti EVI2A pAb (ATL-HPA057051)

Atlas Antibodies

SKU: ATL-HPA057051-25

• 

Protein Description: ecotropic viral integration site 2A
Gene Name: EVI2A
Alternative Gene Name: EVDA, EVI2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000078771: 40%, ENSRNOG00000022764: 46%
Entrez Gene ID: 2123
Uniprot ID: P22794
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MLLRSWFGNKDFQALPILARLPSMPTDMEHTGHYLHLAFLMTTVFSLSPGTKANYT
• Gene Sequence: MLLRSWFGNKDFQALPILARLPSMPTDMEHTGHYLHLAFLMTTVFSLSPGTKANYT
• Gene ID - Mouse: ENSMUSG00000078771
• Gene ID - Rat: ENSRNOG00000022764
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.