Anti EVI2A pAb (ATL-HPA057051)
Atlas Antibodies
- Catalog No.:
- ATL-HPA057051-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: EVI2A
Alternative Gene Name: EVDA, EVI2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000078771: 40%, ENSRNOG00000022764: 46%
Entrez Gene ID: 2123
Uniprot ID: P22794
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | MLLRSWFGNKDFQALPILARLPSMPTDMEHTGHYLHLAFLMTTVFSLSPGTKANYT |
| Gene Sequence | MLLRSWFGNKDFQALPILARLPSMPTDMEHTGHYLHLAFLMTTVFSLSPGTKANYT |
| Gene ID - Mouse | ENSMUSG00000078771 |
| Gene ID - Rat | ENSRNOG00000022764 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti EVI2A pAb (ATL-HPA057051) | |
| Datasheet | Anti EVI2A pAb (ATL-HPA057051) Datasheet (External Link) |
| Vendor Page | Anti EVI2A pAb (ATL-HPA057051) at Atlas Antibodies |
| Documents & Links for Anti EVI2A pAb (ATL-HPA057051) | |
| Datasheet | Anti EVI2A pAb (ATL-HPA057051) Datasheet (External Link) |
| Vendor Page | Anti EVI2A pAb (ATL-HPA057051) |