Anti EVC pAb (ATL-HPA008703)

Atlas Antibodies

Catalog No.:
ATL-HPA008703-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: Ellis van Creveld syndrome
Gene Name: EVC
Alternative Gene Name: DWF-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029122: 62%, ENSRNOG00000007564: 55%
Entrez Gene ID: 2121
Uniprot ID: P57679
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GVMDLLEAQLETQLQEAEQNFISELAALARVPLAESKLLPAKRGLLEKPLRTKRKKPLPQERGDLGVPNNEDLASGDQTSGSLSSKRLSQQESEAGDSGNSKKMLK
Gene Sequence GVMDLLEAQLETQLQEAEQNFISELAALARVPLAESKLLPAKRGLLEKPLRTKRKKPLPQERGDLGVPNNEDLASGDQTSGSLSSKRLSQQESEAGDSGNSKKMLK
Gene ID - Mouse ENSMUSG00000029122
Gene ID - Rat ENSRNOG00000007564
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti EVC pAb (ATL-HPA008703)
Datasheet Anti EVC pAb (ATL-HPA008703) Datasheet (External Link)
Vendor Page Anti EVC pAb (ATL-HPA008703) at Atlas Antibodies

Documents & Links for Anti EVC pAb (ATL-HPA008703)
Datasheet Anti EVC pAb (ATL-HPA008703) Datasheet (External Link)
Vendor Page Anti EVC pAb (ATL-HPA008703)
Citations for Anti EVC pAb (ATL-HPA008703) – 3 Found
Zhang, Honghao; Takeda, Haruko; Tsuji, Takehito; Kamiya, Nobuhiro; Rajderkar, Sudha; Louie, Ke'Ale; Collier, Crystal; Scott, Greg; Ray, Manas; Mochida, Yoshiyuki; Kaartinen, Vesa; Kunieda, Tetsuo; Mishina, Yuji. Generation of Evc2/Limbin global and conditional KO mice and its roles during mineralized tissue formation. Genesis (New York, N.y. : 2000). 2015;53(9):612-626.  PubMed
Zhang, Honghao; Kamiya, Nobuhiro; Tsuji, Takehito; Takeda, Haruko; Scott, Greg; Rajderkar, Sudha; Ray, Manas K; Mochida, Yoshiyuki; Allen, Benjamin; Lefebvre, Veronique; Hung, Irene H; Ornitz, David M; Kunieda, Tetsuo; Mishina, Yuji. Elevated Fibroblast Growth Factor Signaling Is Critical for the Pathogenesis of the Dwarfism in Evc2/Limbin Mutant Mice. Plos Genetics. 2016;12(12):e1006510.  PubMed
Takahashi, Ryutaro; Yamagishi, Makoto; Nakano, Kazumi; Yamochi, Toshiko; Yamochi, Tadanori; Fujikawa, Dai; Nakashima, Makoto; Tanaka, Yuetsu; Uchimaru, Kaoru; Utsunomiya, Atae; Watanabe, Toshiki. Epigenetic deregulation of Ellis Van Creveld confers robust Hedgehog signaling in adult T-cell leukemia. Cancer Science. 2014;105(9):1160-9.  PubMed