Anti ETV5 pAb (ATL-HPA073889)
Atlas Antibodies
- Catalog No.:
- ATL-HPA073889-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: ETV5
Alternative Gene Name: ERM
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000013089: 93%, ENSRNOG00000001785: 93%
Entrez Gene ID: 2119
Uniprot ID: P41161
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC, ChIP-Exo-Seq |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | AAGPVQGVGPAPAPHSLPEPGPQQQTFAVPRPPHQPLQMPKMMPENQYPSEQRFQRQ |
| Gene Sequence | AAGPVQGVGPAPAPHSLPEPGPQQQTFAVPRPPHQPLQMPKMMPENQYPSEQRFQRQ |
| Gene ID - Mouse | ENSMUSG00000013089 |
| Gene ID - Rat | ENSRNOG00000001785 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ETV5 pAb (ATL-HPA073889) | |
| Datasheet | Anti ETV5 pAb (ATL-HPA073889) Datasheet (External Link) |
| Vendor Page | Anti ETV5 pAb (ATL-HPA073889) at Atlas Antibodies |
| Documents & Links for Anti ETV5 pAb (ATL-HPA073889) | |
| Datasheet | Anti ETV5 pAb (ATL-HPA073889) Datasheet (External Link) |
| Vendor Page | Anti ETV5 pAb (ATL-HPA073889) |