Anti ETV3 pAb (ATL-HPA073211)

Atlas Antibodies

Catalog No.:
ATL-HPA073211-100
Shipping:
Calculated at Checkout
$596.00
Adding to cart… The item has been added
Protein Description: ETS variant 3
Gene Name: ETV3
Alternative Gene Name: PE-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000003382: 76%, ENSRNOG00000043095: 75%
Entrez Gene ID: 2117
Uniprot ID: P41162
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SSRFHFPPLDTHSPTNDVQPGRFSASSLTASGQESSNGTDRKTELSELEDGSAADWRRGVDPVSSRNAIGGGGIGHQKR
Gene Sequence SSRFHFPPLDTHSPTNDVQPGRFSASSLTASGQESSNGTDRKTELSELEDGSAADWRRGVDPVSSRNAIGGGGIGHQKR
Gene ID - Mouse ENSMUSG00000003382
Gene ID - Rat ENSRNOG00000043095
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ETV3 pAb (ATL-HPA073211)
Datasheet Anti ETV3 pAb (ATL-HPA073211) Datasheet (External Link)
Vendor Page Anti ETV3 pAb (ATL-HPA073211) at Atlas Antibodies

Documents & Links for Anti ETV3 pAb (ATL-HPA073211)
Datasheet Anti ETV3 pAb (ATL-HPA073211) Datasheet (External Link)
Vendor Page Anti ETV3 pAb (ATL-HPA073211)