Anti ETV1 pAb (ATL-HPA068389)

Atlas Antibodies

Catalog No.:
ATL-HPA068389-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: ETS variant 1
Gene Name: ETV1
Alternative Gene Name: ER81
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000004151: 94%, ENSRNOG00000006867: 94%
Entrez Gene ID: 2115
Uniprot ID: P50549
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TPSSTPVSPLHHASPNSTHTPKPDRAFPAHLPPSQSIPDSSYPMDHRFRRQ
Gene Sequence TPSSTPVSPLHHASPNSTHTPKPDRAFPAHLPPSQSIPDSSYPMDHRFRRQ
Gene ID - Mouse ENSMUSG00000004151
Gene ID - Rat ENSRNOG00000006867
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ETV1 pAb (ATL-HPA068389)
Datasheet Anti ETV1 pAb (ATL-HPA068389) Datasheet (External Link)
Vendor Page Anti ETV1 pAb (ATL-HPA068389) at Atlas Antibodies

Documents & Links for Anti ETV1 pAb (ATL-HPA068389)
Datasheet Anti ETV1 pAb (ATL-HPA068389) Datasheet (External Link)
Vendor Page Anti ETV1 pAb (ATL-HPA068389)