Anti ETV1 pAb (ATL-HPA068389)
Atlas Antibodies
- Catalog No.:
- ATL-HPA068389-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: ETV1
Alternative Gene Name: ER81
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000004151: 94%, ENSRNOG00000006867: 94%
Entrez Gene ID: 2115
Uniprot ID: P50549
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | TPSSTPVSPLHHASPNSTHTPKPDRAFPAHLPPSQSIPDSSYPMDHRFRRQ |
| Gene Sequence | TPSSTPVSPLHHASPNSTHTPKPDRAFPAHLPPSQSIPDSSYPMDHRFRRQ |
| Gene ID - Mouse | ENSMUSG00000004151 |
| Gene ID - Rat | ENSRNOG00000006867 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ETV1 pAb (ATL-HPA068389) | |
| Datasheet | Anti ETV1 pAb (ATL-HPA068389) Datasheet (External Link) |
| Vendor Page | Anti ETV1 pAb (ATL-HPA068389) at Atlas Antibodies |
| Documents & Links for Anti ETV1 pAb (ATL-HPA068389) | |
| Datasheet | Anti ETV1 pAb (ATL-HPA068389) Datasheet (External Link) |
| Vendor Page | Anti ETV1 pAb (ATL-HPA068389) |