Anti ETS1 pAb (ATL-HPA063230)

Atlas Antibodies

Catalog No.:
ATL-HPA063230-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: v-ets avian erythroblastosis virus E26 oncogene homolog 1
Gene Name: ETS1
Alternative Gene Name: ETS-1, EWSR2, FLJ10768
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032035: 92%, ENSRNOG00000008941: 96%
Entrez Gene ID: 2113
Uniprot ID: P14921
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VKPYQVNGVNPAYPESRYTSDYFISYGIEHAQCVPPSEFSEPSFITESYQTLHPISSEELLSLKYENDYPSVILRDPLQTDTLQNDYFAIKQEVVTPDNMCMGRTS
Gene Sequence VKPYQVNGVNPAYPESRYTSDYFISYGIEHAQCVPPSEFSEPSFITESYQTLHPISSEELLSLKYENDYPSVILRDPLQTDTLQNDYFAIKQEVVTPDNMCMGRTS
Gene ID - Mouse ENSMUSG00000032035
Gene ID - Rat ENSRNOG00000008941
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ETS1 pAb (ATL-HPA063230)
Datasheet Anti ETS1 pAb (ATL-HPA063230) Datasheet (External Link)
Vendor Page Anti ETS1 pAb (ATL-HPA063230) at Atlas Antibodies

Documents & Links for Anti ETS1 pAb (ATL-HPA063230)
Datasheet Anti ETS1 pAb (ATL-HPA063230) Datasheet (External Link)
Vendor Page Anti ETS1 pAb (ATL-HPA063230)