Anti ETS1 pAb (ATL-HPA063230)
Atlas Antibodies
- Catalog No.:
- ATL-HPA063230-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: ETS1
Alternative Gene Name: ETS-1, EWSR2, FLJ10768
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032035: 92%, ENSRNOG00000008941: 96%
Entrez Gene ID: 2113
Uniprot ID: P14921
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | VKPYQVNGVNPAYPESRYTSDYFISYGIEHAQCVPPSEFSEPSFITESYQTLHPISSEELLSLKYENDYPSVILRDPLQTDTLQNDYFAIKQEVVTPDNMCMGRTS |
Gene Sequence | VKPYQVNGVNPAYPESRYTSDYFISYGIEHAQCVPPSEFSEPSFITESYQTLHPISSEELLSLKYENDYPSVILRDPLQTDTLQNDYFAIKQEVVTPDNMCMGRTS |
Gene ID - Mouse | ENSMUSG00000032035 |
Gene ID - Rat | ENSRNOG00000008941 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti ETS1 pAb (ATL-HPA063230) | |
Datasheet | Anti ETS1 pAb (ATL-HPA063230) Datasheet (External Link) |
Vendor Page | Anti ETS1 pAb (ATL-HPA063230) at Atlas Antibodies |
Documents & Links for Anti ETS1 pAb (ATL-HPA063230) | |
Datasheet | Anti ETS1 pAb (ATL-HPA063230) Datasheet (External Link) |
Vendor Page | Anti ETS1 pAb (ATL-HPA063230) |