Anti ETNPPL pAb (ATL-HPA072938)

Atlas Antibodies

Catalog No.:
ATL-HPA072938-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: ethanolamine-phosphate phospho-lyase
Gene Name: ETNPPL
Alternative Gene Name: AGXT2L1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019232: 81%, ENSRNOG00000045743: 80%
Entrez Gene ID: 64850
Uniprot ID: Q8TBG4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LAVLDIIENEDLQGNAKRVGNYLTELLKKQKAKHTLIGDIRGIGLFIGIDLVKDHLKRTPATAEAQHIIYKMKEKRVLLSA
Gene Sequence LAVLDIIENEDLQGNAKRVGNYLTELLKKQKAKHTLIGDIRGIGLFIGIDLVKDHLKRTPATAEAQHIIYKMKEKRVLLSA
Gene ID - Mouse ENSMUSG00000019232
Gene ID - Rat ENSRNOG00000045743
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ETNPPL pAb (ATL-HPA072938)
Datasheet Anti ETNPPL pAb (ATL-HPA072938) Datasheet (External Link)
Vendor Page Anti ETNPPL pAb (ATL-HPA072938) at Atlas Antibodies

Documents & Links for Anti ETNPPL pAb (ATL-HPA072938)
Datasheet Anti ETNPPL pAb (ATL-HPA072938) Datasheet (External Link)
Vendor Page Anti ETNPPL pAb (ATL-HPA072938)
Citations for Anti ETNPPL pAb (ATL-HPA072938) – 1 Found
Leventoux, N; Augustus, M; Azar, S; Riquier, S; Villemin, J P; Guelfi, S; Falha, L; Bauchet, L; Gozé, C; Ritchie, W; Commes, T; Duffau, H; Rigau, V; Hugnot, J P. Transformation Foci in IDH1-mutated Gliomas Show STAT3 Phosphorylation and Downregulate the Metabolic Enzyme ETNPPL, a Negative Regulator of Glioma Growth. Scientific Reports. 2020;10(1):5504.  PubMed