Anti ETNPPL pAb (ATL-HPA072938)
Atlas Antibodies
- Catalog No.:
- ATL-HPA072938-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: ETNPPL
Alternative Gene Name: AGXT2L1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019232: 81%, ENSRNOG00000045743: 80%
Entrez Gene ID: 64850
Uniprot ID: Q8TBG4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | LAVLDIIENEDLQGNAKRVGNYLTELLKKQKAKHTLIGDIRGIGLFIGIDLVKDHLKRTPATAEAQHIIYKMKEKRVLLSA |
Gene Sequence | LAVLDIIENEDLQGNAKRVGNYLTELLKKQKAKHTLIGDIRGIGLFIGIDLVKDHLKRTPATAEAQHIIYKMKEKRVLLSA |
Gene ID - Mouse | ENSMUSG00000019232 |
Gene ID - Rat | ENSRNOG00000045743 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti ETNPPL pAb (ATL-HPA072938) | |
Datasheet | Anti ETNPPL pAb (ATL-HPA072938) Datasheet (External Link) |
Vendor Page | Anti ETNPPL pAb (ATL-HPA072938) at Atlas Antibodies |
Documents & Links for Anti ETNPPL pAb (ATL-HPA072938) | |
Datasheet | Anti ETNPPL pAb (ATL-HPA072938) Datasheet (External Link) |
Vendor Page | Anti ETNPPL pAb (ATL-HPA072938) |
Citations for Anti ETNPPL pAb (ATL-HPA072938) – 1 Found |
Leventoux, N; Augustus, M; Azar, S; Riquier, S; Villemin, J P; Guelfi, S; Falha, L; Bauchet, L; Gozé, C; Ritchie, W; Commes, T; Duffau, H; Rigau, V; Hugnot, J P. Transformation Foci in IDH1-mutated Gliomas Show STAT3 Phosphorylation and Downregulate the Metabolic Enzyme ETNPPL, a Negative Regulator of Glioma Growth. Scientific Reports. 2020;10(1):5504. PubMed |