Anti ETFB pAb (ATL-HPA018923)

Atlas Antibodies

SKU:
ATL-HPA018923-25
  • Immunohistochemical staining of human heart muscle shows cytoplasmic positivity with a granular pattern in myocytes.
  • Immunofluorescent staining of human cell line A-431 shows localization to mitochondria.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: electron-transfer-flavoprotein, beta polypeptide
Gene Name: ETFB
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000004610: 65%, ENSRNOG00000017851: 65%
Entrez Gene ID: 2109
Uniprot ID: P38117
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GLALRPPPSCLFPPDPTPSPPAGQIRVKPDRTGVVTDGVKHSMNPFCEIAVEEAVRLKEKKLVKEVIAVSCGPAQCQ
Gene Sequence GLALRPPPSCLFPPDPTPSPPAGQIRVKPDRTGVVTDGVKHSMNPFCEIAVEEAVRLKEKKLVKEVIAVSCGPAQCQ
Gene ID - Mouse ENSMUSG00000004610
Gene ID - Rat ENSRNOG00000017851
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti ETFB pAb (ATL-HPA018923)
Datasheet Anti ETFB pAb (ATL-HPA018923) Datasheet (External Link)
Vendor Page Anti ETFB pAb (ATL-HPA018923) at Atlas Antibodies

Documents & Links for Anti ETFB pAb (ATL-HPA018923)
Datasheet Anti ETFB pAb (ATL-HPA018923) Datasheet (External Link)
Vendor Page Anti ETFB pAb (ATL-HPA018923)