Anti ETF1 pAb (ATL-HPA037511)

Atlas Antibodies

SKU: ATL-HPA037511-25

• 
• 

Protein Description: eukaryotic translation termination factor 1
Gene Name: ETF1
Alternative Gene Name: ERF, ERF1, RF1, SUP45L1, TB3-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024360: 100%, ENSRNOG00000019450: 100%
Entrez Gene ID: 2107
Uniprot ID: P62495
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ILYLTPEQEKDKSHFTDKETGQEHELIESMPLLEWFANNYKKFGATLEIVTDKSQEGSQFVKGFGGIGGILRYRVDFQGMEYQGGDDEF
• Gene Sequence: ILYLTPEQEKDKSHFTDKETGQEHELIESMPLLEWFANNYKKFGATLEIVTDKSQEGSQFVKGFGGIGGILRYRVDFQGMEYQGGDDEF
• Gene ID - Mouse: ENSMUSG00000024360
• Gene ID - Rat: ENSRNOG00000019450
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.