Anti ETF1 pAb (ATL-HPA037511)

Atlas Antibodies

Catalog No.:
ATL-HPA037511-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: eukaryotic translation termination factor 1
Gene Name: ETF1
Alternative Gene Name: ERF, ERF1, RF1, SUP45L1, TB3-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024360: 100%, ENSRNOG00000019450: 100%
Entrez Gene ID: 2107
Uniprot ID: P62495
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ILYLTPEQEKDKSHFTDKETGQEHELIESMPLLEWFANNYKKFGATLEIVTDKSQEGSQFVKGFGGIGGILRYRVDFQGMEYQGGDDEF
Gene Sequence ILYLTPEQEKDKSHFTDKETGQEHELIESMPLLEWFANNYKKFGATLEIVTDKSQEGSQFVKGFGGIGGILRYRVDFQGMEYQGGDDEF
Gene ID - Mouse ENSMUSG00000024360
Gene ID - Rat ENSRNOG00000019450
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ETF1 pAb (ATL-HPA037511)
Datasheet Anti ETF1 pAb (ATL-HPA037511) Datasheet (External Link)
Vendor Page Anti ETF1 pAb (ATL-HPA037511) at Atlas Antibodies

Documents & Links for Anti ETF1 pAb (ATL-HPA037511)
Datasheet Anti ETF1 pAb (ATL-HPA037511) Datasheet (External Link)
Vendor Page Anti ETF1 pAb (ATL-HPA037511)