Anti ESYT1 pAb (ATL-HPA076926)

Atlas Antibodies

SKU:
ATL-HPA076926-25
  • Immunofluorescent staining of human cell line SiHa shows localization to endoplasmic reticulum.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: extended synaptotagmin-like protein 1
Gene Name: ESYT1
Alternative Gene Name: FAM62A, KIAA0747, MBC2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025366: 81%, ENSRNOG00000060753: 81%
Entrez Gene ID: 23344
Uniprot ID: Q9BSJ8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SSGPNSRLYMKLVMRILYLDSSEICFPTVPGCPGAWDVDSENPQRGSSVDAPPRPCHTTPDSQFGTEHVLRIHVLEAQDLIAKDRF
Gene Sequence SSGPNSRLYMKLVMRILYLDSSEICFPTVPGCPGAWDVDSENPQRGSSVDAPPRPCHTTPDSQFGTEHVLRIHVLEAQDLIAKDRF
Gene ID - Mouse ENSMUSG00000025366
Gene ID - Rat ENSRNOG00000060753
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti ESYT1 pAb (ATL-HPA076926)
Datasheet Anti ESYT1 pAb (ATL-HPA076926) Datasheet (External Link)
Vendor Page Anti ESYT1 pAb (ATL-HPA076926) at Atlas Antibodies

Documents & Links for Anti ESYT1 pAb (ATL-HPA076926)
Datasheet Anti ESYT1 pAb (ATL-HPA076926) Datasheet (External Link)
Vendor Page Anti ESYT1 pAb (ATL-HPA076926)