Anti ESR1 pAb (ATL-HPA000449 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA000449-25
- Shipping:
- Calculated at Checkout
$328.00
Gene Name: ESR1
Alternative Gene Name: Era, ESR, NR3A1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019768: 88%, ENSRNOG00000019358: 87%
Entrez Gene ID: 2099
Uniprot ID: P03372
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | FGSNGLGGFPPLNSVSPSPLMLLHPPPQLSPFLQPHGQQVPYYLENEPSGYTVREAGPPAFYRPNSDNRRQGGRERLASTNDKGSMAMESAKETRYCAVCNDYASGYHYGVWSCEGCKAFFKRSIQGHNDYMCPATNQCTID |
| Gene Sequence | FGSNGLGGFPPLNSVSPSPLMLLHPPPQLSPFLQPHGQQVPYYLENEPSGYTVREAGPPAFYRPNSDNRRQGGRERLASTNDKGSMAMESAKETRYCAVCNDYASGYHYGVWSCEGCKAFFKRSIQGHNDYMCPATNQCTID |
| Gene ID - Mouse | ENSMUSG00000019768 |
| Gene ID - Rat | ENSRNOG00000019358 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ESR1 pAb (ATL-HPA000449 w/enhanced validation) | |
| Datasheet | Anti ESR1 pAb (ATL-HPA000449 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti ESR1 pAb (ATL-HPA000449 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti ESR1 pAb (ATL-HPA000449 w/enhanced validation) | |
| Datasheet | Anti ESR1 pAb (ATL-HPA000449 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti ESR1 pAb (ATL-HPA000449 w/enhanced validation) |
| Citations for Anti ESR1 pAb (ATL-HPA000449 w/enhanced validation) – 3 Found |
| Scalia, Carla Rossana; Boi, Giovanna; Bolognesi, Maddalena Maria; Riva, Lorella; Manzoni, Marco; DeSmedt, Linde; Bosisio, Francesca Maria; Ronchi, Susanna; Leone, Biagio Eugenio; Cattoretti, Giorgio. Antigen Masking During Fixation and Embedding, Dissected. The Journal Of Histochemistry And Cytochemistry : Official Journal Of The Histochemistry Society. 2017;65(1):5-20. PubMed |
| Algenäs, Cajsa; Agaton, Charlotta; Fagerberg, Linn; Asplund, Anna; Björling, Lisa; Björling, Erik; Kampf, Caroline; Lundberg, Emma; Nilsson, Peter; Persson, Anja; Wester, Kenneth; Pontén, Fredrik; Wernérus, Henrik; Uhlén, Mathias; Ottosson Takanen, Jenny; Hober, Sophia. Antibody performance in western blot applications is context-dependent. Biotechnology Journal. 2014;9(3):435-45. PubMed |
| Ye, Liping; Lin, Chuyong; Wang, Xi; Li, Qiji; Li, Yue; Wang, Meng; Zhao, Zekun; Wu, Xianqiu; Shi, Dongni; Xiao, Yunyun; Ren, Liangliang; Jian, Yunting; Yang, Meisongzhu; Ou, Ruizhang; Deng, Guangzheng; Ouyang, Ying; Chen, Xiangfu; Li, Jun; Song, Libing. Epigenetic silencing of SALL2 confers tamoxifen resistance in breast cancer. Embo Molecular Medicine. 2019;11(12):e10638. PubMed |