Anti ESPNL pAb (ATL-HPA055103)

Atlas Antibodies

Catalog No.:
ATL-HPA055103-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: espin-like
Gene Name: ESPNL
Alternative Gene Name: FLJ42568
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049515: 57%, ENSRNOG00000024717: 58%
Entrez Gene ID: 339768
Uniprot ID: Q6ZVH7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VHGLVQGDEKPSTRPLQDTCREASASPPRSEAQRQIQEWGVSVRTLRGNFESASGPLCGFNPGPCEPGAQHRQCLSGCWPALPKPRSGLASGEPR
Gene Sequence VHGLVQGDEKPSTRPLQDTCREASASPPRSEAQRQIQEWGVSVRTLRGNFESASGPLCGFNPGPCEPGAQHRQCLSGCWPALPKPRSGLASGEPR
Gene ID - Mouse ENSMUSG00000049515
Gene ID - Rat ENSRNOG00000024717
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ESPNL pAb (ATL-HPA055103)
Datasheet Anti ESPNL pAb (ATL-HPA055103) Datasheet (External Link)
Vendor Page Anti ESPNL pAb (ATL-HPA055103) at Atlas Antibodies

Documents & Links for Anti ESPNL pAb (ATL-HPA055103)
Datasheet Anti ESPNL pAb (ATL-HPA055103) Datasheet (External Link)
Vendor Page Anti ESPNL pAb (ATL-HPA055103)