Anti ESPN pAb (ATL-HPA028674 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA028674-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: ESPN
Alternative Gene Name: DFNB36
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028943: 89%, ENSRNOG00000010270: 89%
Entrez Gene ID: 83715
Uniprot ID: B1AK53
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | SMPAWRRDLLRKKLEEEREQKRKEEERQKQEELRREKEQSEKLRTLGYDESKLAPWQRQVILKK |
Gene Sequence | SMPAWRRDLLRKKLEEEREQKRKEEERQKQEELRREKEQSEKLRTLGYDESKLAPWQRQVILKK |
Gene ID - Mouse | ENSMUSG00000028943 |
Gene ID - Rat | ENSRNOG00000010270 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti ESPN pAb (ATL-HPA028674 w/enhanced validation) | |
Datasheet | Anti ESPN pAb (ATL-HPA028674 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti ESPN pAb (ATL-HPA028674 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti ESPN pAb (ATL-HPA028674 w/enhanced validation) | |
Datasheet | Anti ESPN pAb (ATL-HPA028674 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti ESPN pAb (ATL-HPA028674 w/enhanced validation) |
Citations for Anti ESPN pAb (ATL-HPA028674 w/enhanced validation) – 2 Found |
Shifrin, David A Jr; Crawley, Scott W; Grega-Larson, Nathan E; Tyska, Matthew J. Dynamics of brush border remodeling induced by enteropathogenic E. coli. Gut Microbes. 2014;5(4):504-16. PubMed |
Hickman, T T; Smalt, C; Bobrow, J; Quatieri, T; Liberman, M C. Blast-induced cochlear synaptopathy in chinchillas. Scientific Reports. 2018;8(1):10740. PubMed |