Anti ESPN pAb (ATL-HPA028674 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA028674-25
  • Immunohistochemistry analysis in human testis and skeletal muscle tissues using HPA028674 antibody. Corresponding ESPN RNA-seq data are presented for the same tissues.
  • Western blot analysis in human cell line SK-BR-3.
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: espin
Gene Name: ESPN
Alternative Gene Name: DFNB36
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028943: 89%, ENSRNOG00000010270: 89%
Entrez Gene ID: 83715
Uniprot ID: B1AK53
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SMPAWRRDLLRKKLEEEREQKRKEEERQKQEELRREKEQSEKLRTLGYDESKLAPWQRQVILKK
Gene Sequence SMPAWRRDLLRKKLEEEREQKRKEEERQKQEELRREKEQSEKLRTLGYDESKLAPWQRQVILKK
Gene ID - Mouse ENSMUSG00000028943
Gene ID - Rat ENSRNOG00000010270
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti ESPN pAb (ATL-HPA028674 w/enhanced validation)
Datasheet Anti ESPN pAb (ATL-HPA028674 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ESPN pAb (ATL-HPA028674 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti ESPN pAb (ATL-HPA028674 w/enhanced validation)
Datasheet Anti ESPN pAb (ATL-HPA028674 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ESPN pAb (ATL-HPA028674 w/enhanced validation)



Citations for Anti ESPN pAb (ATL-HPA028674 w/enhanced validation) – 2 Found
Shifrin, David A Jr; Crawley, Scott W; Grega-Larson, Nathan E; Tyska, Matthew J. Dynamics of brush border remodeling induced by enteropathogenic E. coli. Gut Microbes. 2014;5(4):504-16.  PubMed
Hickman, T T; Smalt, C; Bobrow, J; Quatieri, T; Liberman, M C. Blast-induced cochlear synaptopathy in chinchillas. Scientific Reports. 2018;8(1):10740.  PubMed