Anti ESF1 pAb (ATL-HPA047083)

Atlas Antibodies

Catalog No.:
ATL-HPA047083-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: ESF1, nucleolar pre-rRNA processing protein, homolog (S. cerevisiae)
Gene Name: ESF1
Alternative Gene Name: bA526K24.1, C20orf6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000045624: 94%, ENSRNOG00000004777: 94%
Entrez Gene ID: 51575
Uniprot ID: Q9H501
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen AEMALLMMDEDEDSKKHFNYNKIVEHQNLSKKKKKQLMKKKELIEDDFEVNVNDARFQAMYTSHLFNLDPSDPNFKKTKAME
Gene Sequence AEMALLMMDEDEDSKKHFNYNKIVEHQNLSKKKKKQLMKKKELIEDDFEVNVNDARFQAMYTSHLFNLDPSDPNFKKTKAME
Gene ID - Mouse ENSMUSG00000045624
Gene ID - Rat ENSRNOG00000004777
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ESF1 pAb (ATL-HPA047083)
Datasheet Anti ESF1 pAb (ATL-HPA047083) Datasheet (External Link)
Vendor Page Anti ESF1 pAb (ATL-HPA047083) at Atlas Antibodies

Documents & Links for Anti ESF1 pAb (ATL-HPA047083)
Datasheet Anti ESF1 pAb (ATL-HPA047083) Datasheet (External Link)
Vendor Page Anti ESF1 pAb (ATL-HPA047083)