Anti ESD pAb (ATL-HPA039700)

Atlas Antibodies

Catalog No.:
ATL-HPA039700-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: esterase D
Gene Name: ESD
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021996: 90%, ENSRNOG00000009512: 88%
Entrez Gene ID: 2098
Uniprot ID: P10768
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen HDSVELNCKMKFAVYLPPKAETGKCPALYWLSGLTCTEQNFISKSGYHQSASEHGLVVIAPDTSPRGCNIKGEDESWDFGTGAG
Gene Sequence HDSVELNCKMKFAVYLPPKAETGKCPALYWLSGLTCTEQNFISKSGYHQSASEHGLVVIAPDTSPRGCNIKGEDESWDFGTGAG
Gene ID - Mouse ENSMUSG00000021996
Gene ID - Rat ENSRNOG00000009512
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ESD pAb (ATL-HPA039700)
Datasheet Anti ESD pAb (ATL-HPA039700) Datasheet (External Link)
Vendor Page Anti ESD pAb (ATL-HPA039700) at Atlas Antibodies

Documents & Links for Anti ESD pAb (ATL-HPA039700)
Datasheet Anti ESD pAb (ATL-HPA039700) Datasheet (External Link)
Vendor Page Anti ESD pAb (ATL-HPA039700)