Anti ERV3-1 pAb (ATL-HPA017209 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA017209-25
  • Immunohistochemistry analysis in human adrenal gland and liver tissues using HPA017209 antibody. Corresponding ERV3-1 RNA-seq data are presented for the same tissues.
  • Western blot analysis in human cell line RT-4, human cell line U-251 MG, human plasma, human liver tissue and human tonsil tissue.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: endogenous retrovirus group 3, member 1
Gene Name: ERV3-1
Alternative Gene Name: envR, ERV-R, ERV3, H-PLK, HERV-R
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031955: 19%, ENSRNOG00000058476: 24%
Entrez Gene ID: 2086
Uniprot ID: Q14264
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QLAENIASSLHVASCYVCGGMNMGDQWPWEARELMPQDNFTLTASSLEPAPSSQSIWFLKTSIIGKFCIARWGKAFTDPVGELTCLGQQYYNETLGKTLWRGKSNNSESPHPSPFSRFPSLNHSWYQLEA
Gene Sequence QLAENIASSLHVASCYVCGGMNMGDQWPWEARELMPQDNFTLTASSLEPAPSSQSIWFLKTSIIGKFCIARWGKAFTDPVGELTCLGQQYYNETLGKTLWRGKSNNSESPHPSPFSRFPSLNHSWYQLEA
Gene ID - Mouse ENSMUSG00000031955
Gene ID - Rat ENSRNOG00000058476
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.



Documents & Links for Anti ERV3-1 pAb (ATL-HPA017209 w/enhanced validation)
Datasheet Anti ERV3-1 pAb (ATL-HPA017209 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ERV3-1 pAb (ATL-HPA017209 w/enhanced validation)



Citations for Anti ERV3-1 pAb (ATL-HPA017209 w/enhanced validation) – 1 Found
Fei, Chen; Atterby, Christina; Edqvist, Per-Henrik; Pontén, Fredrik; Zhang, Wei Wei; Larsson, Erik; Ryan, Frank P. Detection of the human endogenous retrovirus ERV3-encoded Env-protein in human tissues using antibody-based proteomics. Journal Of The Royal Society Of Medicine. 2014;107(1):22-9.  PubMed