Anti ERMP1 pAb (ATL-HPA055582)
Atlas Antibodies
- Catalog No.:
- ATL-HPA055582-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: ERMP1
Alternative Gene Name: FLJ23309, FXNA, KIAA1815
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000046324: 84%, ENSRNOG00000010915: 84%
Entrez Gene ID: 79956
Uniprot ID: Q7Z2K6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | LGLALYLIALRTLVQLSLQQLVLRGAAGHRGEFDALQARDYLEHITSIGPRTTGSPENEILTVHYLLEQIKLIEVQSNSLHKISVDVQRPTGSFSIDFLGGFTSYYDNITNVVVKLEPRDGAQHAVLAN |
| Gene Sequence | LGLALYLIALRTLVQLSLQQLVLRGAAGHRGEFDALQARDYLEHITSIGPRTTGSPENEILTVHYLLEQIKLIEVQSNSLHKISVDVQRPTGSFSIDFLGGFTSYYDNITNVVVKLEPRDGAQHAVLAN |
| Gene ID - Mouse | ENSMUSG00000046324 |
| Gene ID - Rat | ENSRNOG00000010915 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ERMP1 pAb (ATL-HPA055582) | |
| Datasheet | Anti ERMP1 pAb (ATL-HPA055582) Datasheet (External Link) |
| Vendor Page | Anti ERMP1 pAb (ATL-HPA055582) at Atlas Antibodies |
| Documents & Links for Anti ERMP1 pAb (ATL-HPA055582) | |
| Datasheet | Anti ERMP1 pAb (ATL-HPA055582) Datasheet (External Link) |
| Vendor Page | Anti ERMP1 pAb (ATL-HPA055582) |