Anti ERMP1 pAb (ATL-HPA055582)

Atlas Antibodies

Catalog No.:
ATL-HPA055582-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: endoplasmic reticulum metallopeptidase 1
Gene Name: ERMP1
Alternative Gene Name: FLJ23309, FXNA, KIAA1815
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000046324: 84%, ENSRNOG00000010915: 84%
Entrez Gene ID: 79956
Uniprot ID: Q7Z2K6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LGLALYLIALRTLVQLSLQQLVLRGAAGHRGEFDALQARDYLEHITSIGPRTTGSPENEILTVHYLLEQIKLIEVQSNSLHKISVDVQRPTGSFSIDFLGGFTSYYDNITNVVVKLEPRDGAQHAVLAN
Gene Sequence LGLALYLIALRTLVQLSLQQLVLRGAAGHRGEFDALQARDYLEHITSIGPRTTGSPENEILTVHYLLEQIKLIEVQSNSLHKISVDVQRPTGSFSIDFLGGFTSYYDNITNVVVKLEPRDGAQHAVLAN
Gene ID - Mouse ENSMUSG00000046324
Gene ID - Rat ENSRNOG00000010915
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ERMP1 pAb (ATL-HPA055582)
Datasheet Anti ERMP1 pAb (ATL-HPA055582) Datasheet (External Link)
Vendor Page Anti ERMP1 pAb (ATL-HPA055582) at Atlas Antibodies

Documents & Links for Anti ERMP1 pAb (ATL-HPA055582)
Datasheet Anti ERMP1 pAb (ATL-HPA055582) Datasheet (External Link)
Vendor Page Anti ERMP1 pAb (ATL-HPA055582)