Anti ERMAP pAb (ATL-HPA054672)

Atlas Antibodies

Catalog No.: ATL-HPA054672-25

Protein Description: erythroblast membrane associated protein (Scianna blood group)
Gene Name: ERMAP
Alternative Gene Name: BTN5, RD, SC
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028644: 83%, ENSRNOG00000000335: 81%
Entrez Gene ID: 114625
Uniprot ID: Q96PL5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: IWKQRRAKEKLLYEHVTEVDNLLSDHAKEKGKLHKAVKKLRSELKLKRAAANSGWRRARLHFVAVTLDPD
• Gene Sequence: IWKQRRAKEKLLYEHVTEVDNLLSDHAKEKGKLHKAVKKLRSELKLKRAAANSGWRRARLHFVAVTLDPD
• Gene ID - Mouse: ENSMUSG00000028644
• Gene ID - Rat: ENSRNOG00000000335
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.