Anti ERMAP pAb (ATL-HPA054672)
Atlas Antibodies
- Catalog No.:
- ATL-HPA054672-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: ERMAP
Alternative Gene Name: BTN5, RD, SC
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028644: 83%, ENSRNOG00000000335: 81%
Entrez Gene ID: 114625
Uniprot ID: Q96PL5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | IWKQRRAKEKLLYEHVTEVDNLLSDHAKEKGKLHKAVKKLRSELKLKRAAANSGWRRARLHFVAVTLDPD |
Gene Sequence | IWKQRRAKEKLLYEHVTEVDNLLSDHAKEKGKLHKAVKKLRSELKLKRAAANSGWRRARLHFVAVTLDPD |
Gene ID - Mouse | ENSMUSG00000028644 |
Gene ID - Rat | ENSRNOG00000000335 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti ERMAP pAb (ATL-HPA054672) | |
Datasheet | Anti ERMAP pAb (ATL-HPA054672) Datasheet (External Link) |
Vendor Page | Anti ERMAP pAb (ATL-HPA054672) at Atlas Antibodies |
Documents & Links for Anti ERMAP pAb (ATL-HPA054672) | |
Datasheet | Anti ERMAP pAb (ATL-HPA054672) Datasheet (External Link) |
Vendor Page | Anti ERMAP pAb (ATL-HPA054672) |