Anti ERLIN2 pAb (ATL-HPA002025)
Atlas Antibodies
- Catalog No.:
- ATL-HPA002025-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: ERLIN2
Alternative Gene Name: C8orf2, Erlin-2, NET32, SPFH2, SPG18
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031483: 94%, ENSRNOG00000013763: 95%
Entrez Gene ID: 11160
Uniprot ID: O94905
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC, IHC |
Reactivity | Human, Mouse, Rat |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | KTKLLIAAQKQKVVEKEAETERKKALIEAEKVAQVAEITYGQKVMEKETEKKISEIEDAAFLAREKAKADAECYTAMKIAEANKLKLTPEYLQLMKYKAIASNSKIYFGKDIPNMFMDSAGSVSKQFEGLADKLSFGLEDEPLETATK |
Gene Sequence | KTKLLIAAQKQKVVEKEAETERKKALIEAEKVAQVAEITYGQKVMEKETEKKISEIEDAAFLAREKAKADAECYTAMKIAEANKLKLTPEYLQLMKYKAIASNSKIYFGKDIPNMFMDSAGSVSKQFEGLADKLSFGLEDEPLETATK |
Gene ID - Mouse | ENSMUSG00000031483 |
Gene ID - Rat | ENSRNOG00000013763 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti ERLIN2 pAb (ATL-HPA002025) | |
Datasheet | Anti ERLIN2 pAb (ATL-HPA002025) Datasheet (External Link) |
Vendor Page | Anti ERLIN2 pAb (ATL-HPA002025) at Atlas Antibodies |
Documents & Links for Anti ERLIN2 pAb (ATL-HPA002025) | |
Datasheet | Anti ERLIN2 pAb (ATL-HPA002025) Datasheet (External Link) |
Vendor Page | Anti ERLIN2 pAb (ATL-HPA002025) |
Citations for Anti ERLIN2 pAb (ATL-HPA002025) – 5 Found |
Mulder, Jan; Björling, Erik; Jonasson, Kalle; Wernérus, Henrik; Hober, Sophia; Hökfelt, Tomas; Uhlén, Mathias. Tissue profiling of the mammalian central nervous system using human antibody-based proteomics. Molecular & Cellular Proteomics : Mcp. 2009;8(7):1612-22. PubMed |
Holland, Daniel G; Burleigh, Angela; Git, Anna; Goldgraben, Mae A; Perez-Mancera, Pedro A; Chin, Suet-Feung; Hurtado, Antonio; Bruna, Alejandra; Ali, H Raza; Greenwood, Wendy; Dunning, Mark J; Samarajiwa, Shamith; Menon, Suraj; Rueda, Oscar M; Lynch, Andy G; McKinney, Steven; Ellis, Ian O; Eaves, Connie J; Carroll, Jason S; Curtis, Christina; Aparicio, Samuel; Caldas, Carlos. ZNF703 is a common Luminal B breast cancer oncogene that differentially regulates luminal and basal progenitors in human mammary epithelium. Embo Molecular Medicine. 2011;3(3):167-80. PubMed |
Stadler, Charlotte; Rexhepaj, Elton; Singan, Vasanth R; Murphy, Robert F; Pepperkok, Rainer; Uhlén, Mathias; Simpson, Jeremy C; Lundberg, Emma. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nature Methods. 2013;10(4):315-23. PubMed |
Davies, Jonathan P; Almasy, Katherine M; McDonald, Eli F; Plate, Lars. Comparative Multiplexed Interactomics of SARS-CoV-2 and Homologous Coronavirus Nonstructural Proteins Identifies Unique and Shared Host-Cell Dependencies. Acs Infectious Diseases. 2020;6(12):3174-3189. PubMed |
Tullett, Kirsteen M; Tan, Peck Szee; Park, Hae-Young; Schittenhelm, Ralf B; Michael, Nicole; Li, Rong; Policheni, Antonia N; Gruber, Emily; Huang, Cheng; Fulcher, Alex J; Danne, Jillian C; Czabotar, Peter E; Wakim, Linda M; Mintern, Justine D; Ramm, Georg; Radford, Kristen J; Caminschi, Irina; O'Keeffe, Meredith; Villadangos, Jose A; Wright, Mark D; Blewitt, Marnie E; Heath, William R; Shortman, Ken; Purcell, Anthony W; Nicola, Nicos A; Zhang, Jian-Guo; Lahoud, Mireille H. RNF41 regulates the damage recognition receptor Clec9A and antigen cross-presentation in mouse dendritic cells. Elife. 2020;9( 33264090) PubMed |