Anti ERICH4 pAb (ATL-HPA048484)
Atlas Antibodies
- Catalog No.:
- ATL-HPA048484-25
- Shipping:
- Calculated at Checkout
        
            
        
        
        $447.00
    
         
                            Gene Name: ERICH4
Alternative Gene Name: C19orf69, LOC100170765
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000074261: 54%, ENSRNOG00000037798: 56%
Entrez Gene ID: 100170765
Uniprot ID: A6NGS2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC | 
| Reactivity | Human | 
| Clonality | Polyclonal | 
| Host | Rabbit | 
| Immunogen | SSETMELWRQLNQAGLVPPGLGPPPQALREVSPVEIPGQTLRTAGADTGGACDS | 
| Gene Sequence | SSETMELWRQLNQAGLVPPGLGPPPQALREVSPVEIPGQTLRTAGADTGGACDS | 
| Gene ID - Mouse | ENSMUSG00000074261 | 
| Gene ID - Rat | ENSRNOG00000037798 | 
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. | 
| Documents & Links for Anti ERICH4 pAb (ATL-HPA048484) | |
| Datasheet | Anti ERICH4 pAb (ATL-HPA048484) Datasheet (External Link) | 
| Vendor Page | Anti ERICH4 pAb (ATL-HPA048484) at Atlas Antibodies | 
| Documents & Links for Anti ERICH4 pAb (ATL-HPA048484) | |
| Datasheet | Anti ERICH4 pAb (ATL-HPA048484) Datasheet (External Link) | 
| Vendor Page | Anti ERICH4 pAb (ATL-HPA048484) | 
 
         
                             
                                        