Anti ERI2 pAb (ATL-HPA035384)

Atlas Antibodies

Catalog No.: ATL-HPA035384-25

Protein Description: ERI1 exoribonuclease family member 2
Gene Name: ERI2
Alternative Gene Name: EXOD1, KIAA1504, MGC16943, ZGRF5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030929: 59%, ENSRNOG00000014673: 64%
Entrez Gene ID: 112479
Uniprot ID: A8K979
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TVPISDSDLEISFNSGERLMVLKELEMSSHENFGDIEETPQKSETSKSIVYKSPHTTIYNVKEAKDPGSDISAFKLPEHKSSTFNRVNANMSHPLVLGKHPLLSGG
• Gene Sequence: TVPISDSDLEISFNSGERLMVLKELEMSSHENFGDIEETPQKSETSKSIVYKSPHTTIYNVKEAKDPGSDISAFKLPEHKSSTFNRVNANMSHPLVLGKHPLLSGG
• Gene ID - Mouse: ENSMUSG00000030929
• Gene ID - Rat: ENSRNOG00000014673
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.