Anti ERI2 pAb (ATL-HPA035384)

Atlas Antibodies

Catalog No.:
ATL-HPA035384-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: ERI1 exoribonuclease family member 2
Gene Name: ERI2
Alternative Gene Name: EXOD1, KIAA1504, MGC16943, ZGRF5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030929: 59%, ENSRNOG00000014673: 64%
Entrez Gene ID: 112479
Uniprot ID: A8K979
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TVPISDSDLEISFNSGERLMVLKELEMSSHENFGDIEETPQKSETSKSIVYKSPHTTIYNVKEAKDPGSDISAFKLPEHKSSTFNRVNANMSHPLVLGKHPLLSGG
Gene Sequence TVPISDSDLEISFNSGERLMVLKELEMSSHENFGDIEETPQKSETSKSIVYKSPHTTIYNVKEAKDPGSDISAFKLPEHKSSTFNRVNANMSHPLVLGKHPLLSGG
Gene ID - Mouse ENSMUSG00000030929
Gene ID - Rat ENSRNOG00000014673
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ERI2 pAb (ATL-HPA035384)
Datasheet Anti ERI2 pAb (ATL-HPA035384) Datasheet (External Link)
Vendor Page Anti ERI2 pAb (ATL-HPA035384) at Atlas Antibodies

Documents & Links for Anti ERI2 pAb (ATL-HPA035384)
Datasheet Anti ERI2 pAb (ATL-HPA035384) Datasheet (External Link)
Vendor Page Anti ERI2 pAb (ATL-HPA035384)