Anti ERI1 pAb (ATL-HPA056074)

Atlas Antibodies

SKU:
ATL-HPA056074-25
  • Immunohistochemical staining of human lymph node shows strong cytoplasmic positivity in non-germinal center cells.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: exoribonuclease 1
Gene Name: ERI1
Alternative Gene Name: 3'HEXO, THEX1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031527: 95%, ENSRNOG00000011448: 97%
Entrez Gene ID: 90459
Uniprot ID: Q8IV48
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ELRAKLSEFKLETRGVKDVLKKRLKNYYKKQKLMLKESNFADSYYDYICIIDFEATCEE
Gene Sequence ELRAKLSEFKLETRGVKDVLKKRLKNYYKKQKLMLKESNFADSYYDYICIIDFEATCEE
Gene ID - Mouse ENSMUSG00000031527
Gene ID - Rat ENSRNOG00000011448
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti ERI1 pAb (ATL-HPA056074)
Datasheet Anti ERI1 pAb (ATL-HPA056074) Datasheet (External Link)
Vendor Page Anti ERI1 pAb (ATL-HPA056074) at Atlas Antibodies

Documents & Links for Anti ERI1 pAb (ATL-HPA056074)
Datasheet Anti ERI1 pAb (ATL-HPA056074) Datasheet (External Link)
Vendor Page Anti ERI1 pAb (ATL-HPA056074)