Anti ERI1 pAb (ATL-HPA055548)

Atlas Antibodies

Catalog No.:
ATL-HPA055548-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: exoribonuclease 1
Gene Name: ERI1
Alternative Gene Name: 3'HEXO, THEX1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031527: 93%, ENSRNOG00000011448: 96%
Entrez Gene ID: 90459
Uniprot ID: Q8IV48
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FYKVPRSQTKLTIMLEKLGMDYDGRPHCGLDDSKNIARIAVRMLQDGCELRINEKMHAGQLMSVSSS
Gene Sequence FYKVPRSQTKLTIMLEKLGMDYDGRPHCGLDDSKNIARIAVRMLQDGCELRINEKMHAGQLMSVSSS
Gene ID - Mouse ENSMUSG00000031527
Gene ID - Rat ENSRNOG00000011448
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ERI1 pAb (ATL-HPA055548)
Datasheet Anti ERI1 pAb (ATL-HPA055548) Datasheet (External Link)
Vendor Page Anti ERI1 pAb (ATL-HPA055548) at Atlas Antibodies

Documents & Links for Anti ERI1 pAb (ATL-HPA055548)
Datasheet Anti ERI1 pAb (ATL-HPA055548) Datasheet (External Link)
Vendor Page Anti ERI1 pAb (ATL-HPA055548)