Anti ERF pAb (ATL-HPA058532)

Atlas Antibodies

Catalog No.:
ATL-HPA058532-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: Ets2 repressor factor
Gene Name: ERF
Alternative Gene Name: PE-2, PE2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040857: 88%, ENSRNOG00000020426: 90%
Entrez Gene ID: 2077
Uniprot ID: P50548
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KPEPGEAPGASQCMPLKLRFKRRWSEDCRLEGGGGPAGGFEDEGEDKKVRG
Gene Sequence KPEPGEAPGASQCMPLKLRFKRRWSEDCRLEGGGGPAGGFEDEGEDKKVRG
Gene ID - Mouse ENSMUSG00000040857
Gene ID - Rat ENSRNOG00000020426
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ERF pAb (ATL-HPA058532)
Datasheet Anti ERF pAb (ATL-HPA058532) Datasheet (External Link)
Vendor Page Anti ERF pAb (ATL-HPA058532) at Atlas Antibodies

Documents & Links for Anti ERF pAb (ATL-HPA058532)
Datasheet Anti ERF pAb (ATL-HPA058532) Datasheet (External Link)
Vendor Page Anti ERF pAb (ATL-HPA058532)